Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4751858..4752374 | Replicon | chromosome |
Accession | NZ_CP102877 | ||
Organism | Klebsiella pneumoniae strain KH1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A486Q7B5 |
Locus tag | NWT87_RS23445 | Protein ID | WP_004192395.1 |
Coordinates | 4751858..4752142 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A483GCT9 |
Locus tag | NWT87_RS23450 | Protein ID | WP_004192397.1 |
Coordinates | 4752132..4752374 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWT87_RS23420 (4747275) | 4747275..4747538 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
NWT87_RS23425 (4747668) | 4747668..4747841 | + | 174 | WP_002886906.1 | hypothetical protein | - |
NWT87_RS23430 (4747844) | 4747844..4748587 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
NWT87_RS23435 (4748944) | 4748944..4751082 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NWT87_RS23440 (4751390) | 4751390..4751854 | + | 465 | WP_004192393.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NWT87_RS23445 (4751858) | 4751858..4752142 | - | 285 | WP_004192395.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NWT87_RS23450 (4752132) | 4752132..4752374 | - | 243 | WP_004192397.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NWT87_RS23455 (4752452) | 4752452..4754362 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
NWT87_RS23460 (4754385) | 4754385..4755539 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
NWT87_RS23465 (4755606) | 4755606..4756346 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11184.03 Da Isoelectric Point: 10.3787
>T254360 WP_004192395.1 NZ_CP102877:c4752142-4751858 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQVNKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQVNKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A486Q7B5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483GCT9 |