Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
| Location | 4666045..4666771 | Replicon | chromosome |
| Accession | NZ_CP102877 | ||
| Organism | Klebsiella pneumoniae strain KH1 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | NWT87_RS23075 | Protein ID | WP_032437356.1 |
| Coordinates | 4666045..4666386 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NWT87_RS23080 | Protein ID | WP_032437354.1 |
| Coordinates | 4666421..4666771 (-) | Length | 117 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWT87_RS23045 (4661052) | 4661052..4662323 | + | 1272 | Protein_4517 | conjugative transfer system coupling protein TraD | - |
| NWT87_RS23050 (4662286) | 4662286..4662552 | + | 267 | WP_004178415.1 | hypothetical protein | - |
| NWT87_RS23055 (4662552) | 4662552..4663224 | + | 673 | Protein_4519 | DUF4400 domain-containing protein | - |
| NWT87_RS23060 (4663235) | 4663235..4664119 | + | 885 | WP_004192285.1 | RES domain-containing protein | - |
| NWT87_RS23065 (4664318) | 4664318..4664506 | - | 189 | Protein_4521 | transposase | - |
| NWT87_RS23070 (4664523) | 4664523..4665634 | - | 1112 | Protein_4522 | IS3 family transposase | - |
| NWT87_RS23075 (4666045) | 4666045..4666386 | - | 342 | WP_032437356.1 | TA system toxin CbtA family protein | Toxin |
| NWT87_RS23080 (4666421) | 4666421..4666771 | - | 351 | WP_032437354.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NWT87_RS23085 (4666792) | 4666792..4667013 | - | 222 | WP_063931680.1 | DUF987 domain-containing protein | - |
| NWT87_RS23090 (4667029) | 4667029..4667502 | - | 474 | WP_032437352.1 | DNA repair protein RadC | - |
| NWT87_RS23095 (4667573) | 4667573..4668394 | - | 822 | WP_187982516.1 | DUF932 domain-containing protein | - |
| NWT87_RS23100 (4668490) | 4668490..4669167 | - | 678 | WP_032437348.1 | hypothetical protein | - |
| NWT87_RS23105 (4669453) | 4669453..4670346 | - | 894 | WP_032437346.1 | 50S ribosome-binding GTPase | - |
| NWT87_RS23110 (4670444) | 4670444..4671595 | + | 1152 | WP_129075233.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4656397..4695225 | 38828 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12991.04 Da Isoelectric Point: 5.0978
>T254359 WP_032437356.1 NZ_CP102877:c4666386-4666045 [Klebsiella pneumoniae]
MNTLPVINQRAIQLCPSPVTIWQTLLTRLLEQHYGLALNDTPFGDESVIQEHIEAGITLVDAVNFLVEKYELVRIDRWAF
GWLEPSPYLRAEDILRMRRDMGLLRGCNHTAAM
MNTLPVINQRAIQLCPSPVTIWQTLLTRLLEQHYGLALNDTPFGDESVIQEHIEAGITLVDAVNFLVEKYELVRIDRWAF
GWLEPSPYLRAEDILRMRRDMGLLRGCNHTAAM
Download Length: 342 bp
Antitoxin
Download Length: 117 a.a. Molecular weight: 12859.60 Da Isoelectric Point: 6.3108
>AT254359 WP_032437354.1 NZ_CP102877:c4666771-4666421 [Klebsiella pneumoniae]
MSNKTQTVNGDTAEPRWGLSCNVIPCFGARLVQEGNRLHYLADRASITGQFNEADLIHPDQAFPVLLKQAELMLTSGELN
PRHQHCVTFCEKGLTCEADTLGSCGHVYIVIYPTQR
MSNKTQTVNGDTAEPRWGLSCNVIPCFGARLVQEGNRLHYLADRASITGQFNEADLIHPDQAFPVLLKQAELMLTSGELN
PRHQHCVTFCEKGLTCEADTLGSCGHVYIVIYPTQR
Download Length: 351 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|