Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4627140..4627950 | Replicon | chromosome |
Accession | NZ_CP102877 | ||
Organism | Klebsiella pneumoniae strain KH1 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A483G813 |
Locus tag | NWT87_RS22855 | Protein ID | WP_023279404.1 |
Coordinates | 4627140..4627673 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | NWT87_RS22860 | Protein ID | WP_002887278.1 |
Coordinates | 4627684..4627950 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWT87_RS22850 (4625971) | 4625971..4627092 | + | 1122 | WP_002887282.1 | cupin domain-containing protein | - |
NWT87_RS22855 (4627140) | 4627140..4627673 | - | 534 | WP_023279404.1 | type II toxin-antitoxin system toxin KacT | Toxin |
NWT87_RS22860 (4627684) | 4627684..4627950 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
NWT87_RS22865 (4628053) | 4628053..4629486 | - | 1434 | WP_258323903.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
NWT87_RS22870 (4629476) | 4629476..4630159 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
NWT87_RS22875 (4630331) | 4630331..4631716 | + | 1386 | WP_004192218.1 | efflux transporter outer membrane subunit | - |
NWT87_RS22880 (4631734) | 4631734..4632078 | + | 345 | WP_004192220.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19809.71 Da Isoelectric Point: 6.2369
>T254358 WP_023279404.1 NZ_CP102877:c4627673-4627140 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDKNSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDKNSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A483G813 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |