Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4025240..4025859 Replicon chromosome
Accession NZ_CP102877
Organism Klebsiella pneumoniae strain KH1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NWT87_RS19970 Protein ID WP_002892050.1
Coordinates 4025641..4025859 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NWT87_RS19965 Protein ID WP_002892066.1
Coordinates 4025240..4025614 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWT87_RS19955 (4020392) 4020392..4021585 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NWT87_RS19960 (4021608) 4021608..4024754 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NWT87_RS19965 (4025240) 4025240..4025614 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NWT87_RS19970 (4025641) 4025641..4025859 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NWT87_RS19975 (4026018) 4026018..4026584 + 567 WP_004191639.1 maltose O-acetyltransferase -
NWT87_RS19980 (4026556) 4026556..4026696 - 141 WP_004147370.1 hypothetical protein -
NWT87_RS19985 (4026717) 4026717..4027187 + 471 WP_002892026.1 YlaC family protein -
NWT87_RS19990 (4027162) 4027162..4028613 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NWT87_RS19995 (4028714) 4028714..4029412 + 699 WP_002892021.1 GNAT family protein -
NWT87_RS20000 (4029409) 4029409..4029549 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NWT87_RS20005 (4029549) 4029549..4029812 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T254357 WP_002892050.1 NZ_CP102877:4025641-4025859 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT254357 WP_002892066.1 NZ_CP102877:4025240-4025614 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References