Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 6992..7635 Replicon plasmid pKA2-5
Accession NZ_CP102874
Organism Klebsiella pneumoniae strain KA2

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NWT85_RS29160 Protein ID WP_001044770.1
Coordinates 7219..7635 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NWT85_RS29155 Protein ID WP_001261282.1
Coordinates 6992..7222 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWT85_RS29115 (NWT85_29115) 2174..2476 + 303 WP_071571079.1 hypothetical protein -
NWT85_RS29120 (NWT85_29120) 2972..3766 - 795 WP_004197635.1 site-specific integrase -
NWT85_RS29125 (NWT85_29125) 3964..4680 - 717 Protein_4 hypothetical protein -
NWT85_RS29130 (NWT85_29130) 4975..5289 - 315 WP_053389906.1 hypothetical protein -
NWT85_RS29135 (NWT85_29135) 5316..5711 - 396 WP_017899885.1 hypothetical protein -
NWT85_RS29140 (NWT85_29140) 5880..6185 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB -
NWT85_RS29145 (NWT85_29145) 6187..6405 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA -
NWT85_RS29150 (NWT85_29150) 6575..7035 - 461 Protein_9 hypothetical protein -
NWT85_RS29155 (NWT85_29155) 6992..7222 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NWT85_RS29160 (NWT85_29160) 7219..7635 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NWT85_RS29165 (NWT85_29165) 7709..8605 + 897 Protein_12 ATP-binding protein -
NWT85_RS29170 (NWT85_29170) 8656..9360 - 705 WP_001067858.1 IS6-like element IS26 family transposase -
NWT85_RS29175 (NWT85_29175) 9473..10288 - 816 WP_000018326.1 aminoglycoside O-phosphotransferase APH(3')-Ia -
NWT85_RS29180 (NWT85_29180) 10418..10492 + 75 Protein_15 IS6 family transposase -
NWT85_RS29185 (NWT85_29185) 10542..11246 - 705 WP_001067858.1 IS6-like element IS26 family transposase -
NWT85_RS29190 (NWT85_29190) 11237..12064 + 828 WP_000534216.1 replication initiation protein RepM -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(3')-Ia / mph(E) / msr(E) / armA - 1..65073 65073


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T254347 WP_001044770.1 NZ_CP102874:7219-7635 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT254347 WP_001261282.1 NZ_CP102874:6992-7222 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References