Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 6992..7635 | Replicon | plasmid pKA2-5 |
| Accession | NZ_CP102874 | ||
| Organism | Klebsiella pneumoniae strain KA2 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | NWT85_RS29160 | Protein ID | WP_001044770.1 |
| Coordinates | 7219..7635 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | NWT85_RS29155 | Protein ID | WP_001261282.1 |
| Coordinates | 6992..7222 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NWT85_RS29115 (NWT85_29115) | 2174..2476 | + | 303 | WP_071571079.1 | hypothetical protein | - |
| NWT85_RS29120 (NWT85_29120) | 2972..3766 | - | 795 | WP_004197635.1 | site-specific integrase | - |
| NWT85_RS29125 (NWT85_29125) | 3964..4680 | - | 717 | Protein_4 | hypothetical protein | - |
| NWT85_RS29130 (NWT85_29130) | 4975..5289 | - | 315 | WP_053389906.1 | hypothetical protein | - |
| NWT85_RS29135 (NWT85_29135) | 5316..5711 | - | 396 | WP_017899885.1 | hypothetical protein | - |
| NWT85_RS29140 (NWT85_29140) | 5880..6185 | - | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | - |
| NWT85_RS29145 (NWT85_29145) | 6187..6405 | - | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| NWT85_RS29150 (NWT85_29150) | 6575..7035 | - | 461 | Protein_9 | hypothetical protein | - |
| NWT85_RS29155 (NWT85_29155) | 6992..7222 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NWT85_RS29160 (NWT85_29160) | 7219..7635 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NWT85_RS29165 (NWT85_29165) | 7709..8605 | + | 897 | Protein_12 | ATP-binding protein | - |
| NWT85_RS29170 (NWT85_29170) | 8656..9360 | - | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
| NWT85_RS29175 (NWT85_29175) | 9473..10288 | - | 816 | WP_000018326.1 | aminoglycoside O-phosphotransferase APH(3')-Ia | - |
| NWT85_RS29180 (NWT85_29180) | 10418..10492 | + | 75 | Protein_15 | IS6 family transposase | - |
| NWT85_RS29185 (NWT85_29185) | 10542..11246 | - | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
| NWT85_RS29190 (NWT85_29190) | 11237..12064 | + | 828 | WP_000534216.1 | replication initiation protein RepM | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(3')-Ia / mph(E) / msr(E) / armA | - | 1..65073 | 65073 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T254347 WP_001044770.1 NZ_CP102874:7219-7635 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |