Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 5880..6405 Replicon plasmid pKA2-5
Accession NZ_CP102874
Organism Klebsiella pneumoniae strain KA2

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag NWT85_RS29140 Protein ID WP_013023785.1
Coordinates 5880..6185 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag NWT85_RS29145 Protein ID WP_001568025.1
Coordinates 6187..6405 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWT85_RS29110 (NWT85_29110) 1551..2177 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
NWT85_RS29115 (NWT85_29115) 2174..2476 + 303 WP_071571079.1 hypothetical protein -
NWT85_RS29120 (NWT85_29120) 2972..3766 - 795 WP_004197635.1 site-specific integrase -
NWT85_RS29125 (NWT85_29125) 3964..4680 - 717 Protein_4 hypothetical protein -
NWT85_RS29130 (NWT85_29130) 4975..5289 - 315 WP_053389906.1 hypothetical protein -
NWT85_RS29135 (NWT85_29135) 5316..5711 - 396 WP_017899885.1 hypothetical protein -
NWT85_RS29140 (NWT85_29140) 5880..6185 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
NWT85_RS29145 (NWT85_29145) 6187..6405 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NWT85_RS29150 (NWT85_29150) 6575..7035 - 461 Protein_9 hypothetical protein -
NWT85_RS29155 (NWT85_29155) 6992..7222 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin -
NWT85_RS29160 (NWT85_29160) 7219..7635 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin -
NWT85_RS29165 (NWT85_29165) 7709..8605 + 897 Protein_12 ATP-binding protein -
NWT85_RS29170 (NWT85_29170) 8656..9360 - 705 WP_001067858.1 IS6-like element IS26 family transposase -
NWT85_RS29175 (NWT85_29175) 9473..10288 - 816 WP_000018326.1 aminoglycoside O-phosphotransferase APH(3')-Ia -
NWT85_RS29180 (NWT85_29180) 10418..10492 + 75 Protein_15 IS6 family transposase -
NWT85_RS29185 (NWT85_29185) 10542..11246 - 705 WP_001067858.1 IS6-like element IS26 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(3')-Ia / mph(E) / msr(E) / armA - 1..65073 65073


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T254346 WP_013023785.1 NZ_CP102874:c6185-5880 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT254346 WP_001568025.1 NZ_CP102874:c6405-6187 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References