Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 44522..45047 Replicon plasmid pKA2-3-mcr8.1
Accession NZ_CP102872
Organism Klebsiella pneumoniae strain KA2

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag NWT85_RS28085 Protein ID WP_013023785.1
Coordinates 44742..45047 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag NWT85_RS28080 Protein ID WP_001568025.1
Coordinates 44522..44740 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWT85_RS28060 (NWT85_28060) 39769..40737 + 969 WP_075211999.1 IS5 family transposase -
NWT85_RS28065 (NWT85_28065) 41209..42000 - 792 WP_221928726.1 ribbon-helix-helix domain-containing protein -
NWT85_RS28070 (NWT85_28070) 42183..43211 - 1029 WP_032445668.1 Abi family protein -
NWT85_RS28075 (NWT85_28075) 43372..43953 - 582 WP_072310991.1 hypothetical protein -
NWT85_RS28080 (NWT85_28080) 44522..44740 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NWT85_RS28085 (NWT85_28085) 44742..45047 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
NWT85_RS28090 (NWT85_28090) 45216..45611 + 396 WP_017899885.1 hypothetical protein -
NWT85_RS28095 (NWT85_28095) 45638..45952 + 315 WP_053389906.1 hypothetical protein -
NWT85_RS28100 (NWT85_28100) 46247..46963 + 717 Protein_52 hypothetical protein -
NWT85_RS28105 (NWT85_28105) 47161..47946 + 786 WP_046664219.1 site-specific integrase -
NWT85_RS28110 (NWT85_28110) 48395..49150 + 756 WP_001568031.1 replication initiation protein RepE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / blaCTX-M-3 / mcr-8 - 1..118931 118931
- flank IS/Tn mcr-8 - 33712..40737 7025


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T254345 WP_013023785.1 NZ_CP102872:44742-45047 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT254345 WP_001568025.1 NZ_CP102872:44522-44740 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References