Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 138709..139361 | Replicon | plasmid pKA2-1 |
Accession | NZ_CP102870 | ||
Organism | Klebsiella pneumoniae strain KA2 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A8A2Q2K1 |
Locus tag | NWT85_RS26545 | Protein ID | WP_017901321.1 |
Coordinates | 138709..139134 (-) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | A0A853H7M9 |
Locus tag | NWT85_RS26550 | Protein ID | WP_001261275.1 |
Coordinates | 139131..139361 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWT85_RS26520 (NWT85_26520) | 134840..135067 | + | 228 | Protein_152 | IS3 family transposase | - |
NWT85_RS26525 (NWT85_26525) | 135159..136715 | - | 1557 | WP_025999314.1 | sensor domain-containing diguanylate cyclase | - |
NWT85_RS26530 (NWT85_26530) | 136902..137075 | - | 174 | Protein_154 | nuclease | - |
NWT85_RS26535 (NWT85_26535) | 137128..137664 | - | 537 | Protein_155 | integrase core domain-containing protein | - |
NWT85_RS26540 (NWT85_26540) | 137723..138691 | - | 969 | WP_258335048.1 | IS5 family transposase | - |
NWT85_RS26545 (NWT85_26545) | 138709..139134 | - | 426 | WP_017901321.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NWT85_RS26550 (NWT85_26550) | 139131..139361 | - | 231 | WP_001261275.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NWT85_RS26555 (NWT85_26555) | 139614..142190 | - | 2577 | WP_017901322.1 | nuclease domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | dfrA12 / aadA2 / qacE / sul1 / mph(A) / aph(3')-Ia / aph(3'')-Ib / aph(6)-Id / tet(A) / mph(E) / msr(E) / armA / blaDHA-1 / qnrB4 / blaTEM-1B / aac(3)-IId | - | 1..257713 | 257713 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15412.91 Da Isoelectric Point: 7.1364
>T254343 WP_017901321.1 NZ_CP102870:c139134-138709 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVGFVE
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8A2Q2K1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A853H7M9 |