Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4730431..4730947 | Replicon | chromosome |
Accession | NZ_CP102869 | ||
Organism | Klebsiella pneumoniae strain KA2 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | NWT85_RS23125 | Protein ID | WP_004178374.1 |
Coordinates | 4730431..4730715 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | NWT85_RS23130 | Protein ID | WP_002886901.1 |
Coordinates | 4730705..4730947 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWT85_RS23100 (NWT85_23100) | 4725827..4726090 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
NWT85_RS23105 (NWT85_23105) | 4726220..4726393 | + | 174 | WP_032103426.1 | hypothetical protein | - |
NWT85_RS23110 (NWT85_23110) | 4726396..4727139 | + | 744 | WP_258334896.1 | MurR/RpiR family transcriptional regulator | - |
NWT85_RS23115 (NWT85_23115) | 4727496..4729634 | + | 2139 | WP_255081622.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NWT85_RS23120 (NWT85_23120) | 4729963..4730427 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NWT85_RS23125 (NWT85_23125) | 4730431..4730715 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NWT85_RS23130 (NWT85_23130) | 4730705..4730947 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NWT85_RS23135 (NWT85_23135) | 4731025..4732935 | - | 1911 | WP_015959311.1 | PRD domain-containing protein | - |
NWT85_RS23140 (NWT85_23140) | 4732958..4734112 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
NWT85_RS23145 (NWT85_23145) | 4734179..4734919 | - | 741 | WP_015959310.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T254339 WP_004178374.1 NZ_CP102869:c4730715-4730431 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |