Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3976096..3976715 Replicon chromosome
Accession NZ_CP102869
Organism Klebsiella pneumoniae strain KA2

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NWT85_RS19590 Protein ID WP_002892050.1
Coordinates 3976497..3976715 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NWT85_RS19585 Protein ID WP_002892066.1
Coordinates 3976096..3976470 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWT85_RS19575 (NWT85_19575) 3971248..3972441 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NWT85_RS19580 (NWT85_19580) 3972464..3975610 + 3147 WP_004147373.1 multidrug efflux RND transporter permease subunit AcrB -
NWT85_RS19585 (NWT85_19585) 3976096..3976470 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NWT85_RS19590 (NWT85_19590) 3976497..3976715 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NWT85_RS19595 (NWT85_19595) 3976874..3977440 + 567 WP_002892030.1 maltose O-acetyltransferase -
NWT85_RS19600 (NWT85_19600) 3977412..3977552 - 141 WP_004147370.1 hypothetical protein -
NWT85_RS19605 (NWT85_19605) 3977573..3978043 + 471 WP_002892026.1 YlaC family protein -
NWT85_RS19610 (NWT85_19610) 3978018..3979469 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NWT85_RS19615 (NWT85_19615) 3979570..3980268 + 699 WP_032434109.1 GNAT family protein -
NWT85_RS19620 (NWT85_19620) 3980265..3980405 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NWT85_RS19625 (NWT85_19625) 3980405..3980668 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T254337 WP_002892050.1 NZ_CP102869:3976497-3976715 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT254337 WP_002892066.1 NZ_CP102869:3976096-3976470 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References