Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1274644..1275561 | Replicon | chromosome |
Accession | NZ_CP102866 | ||
Organism | Bacillus velezensis strain YS-AT-DS1 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | NWE25_RS06355 | Protein ID | WP_007407256.1 |
Coordinates | 1274815..1275561 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | NWE25_RS06350 | Protein ID | WP_003154807.1 |
Coordinates | 1274644..1274814 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWE25_RS06300 (NWE25_06300) | 1269796..1270308 | + | 513 | WP_032874577.1 | sigma-70 family RNA polymerase sigma factor | - |
NWE25_RS06305 (NWE25_06305) | 1270421..1270747 | + | 327 | WP_228842184.1 | hypothetical protein | - |
NWE25_RS06310 (NWE25_06310) | 1270857..1271498 | + | 642 | WP_228842183.1 | hypothetical protein | - |
NWE25_RS06315 (NWE25_06315) | 1271511..1271882 | + | 372 | WP_038457736.1 | XkdW family protein | - |
NWE25_RS06320 (NWE25_06320) | 1271887..1272084 | + | 198 | WP_007610833.1 | XkdX family protein | - |
NWE25_RS06325 (NWE25_06325) | 1272141..1272902 | + | 762 | WP_038457737.1 | hypothetical protein | - |
NWE25_RS06330 (NWE25_06330) | 1272955..1273218 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
NWE25_RS06335 (NWE25_06335) | 1273232..1273495 | + | 264 | WP_003154813.1 | phage holin | - |
NWE25_RS06340 (NWE25_06340) | 1273509..1274387 | + | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
NWE25_RS06345 (NWE25_06345) | 1274422..1274547 | - | 126 | WP_003154809.1 | hypothetical protein | - |
NWE25_RS06350 (NWE25_06350) | 1274644..1274814 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
NWE25_RS06355 (NWE25_06355) | 1274815..1275561 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NWE25_RS06360 (NWE25_06360) | 1275666..1276664 | - | 999 | WP_032874611.1 | inorganic phosphate transporter | - |
NWE25_RS06365 (NWE25_06365) | 1276677..1277294 | - | 618 | WP_032874614.1 | DUF47 domain-containing protein | - |
NWE25_RS06370 (NWE25_06370) | 1277579..1278895 | - | 1317 | WP_038457739.1 | amino acid permease | - |
NWE25_RS06375 (NWE25_06375) | 1279218..1280168 | + | 951 | WP_007610844.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T254327 WP_007407256.1 NZ_CP102866:c1275561-1274815 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|