Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 482201..482838 | Replicon | chromosome |
Accession | NZ_CP102866 | ||
Organism | Bacillus velezensis strain YS-AT-DS1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NWE25_RS02475 | Protein ID | WP_003156187.1 |
Coordinates | 482488..482838 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | NWE25_RS02470 | Protein ID | WP_003156188.1 |
Coordinates | 482201..482482 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWE25_RS02450 (NWE25_02450) | 478566..479165 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
NWE25_RS02455 (NWE25_02455) | 479258..479623 | + | 366 | WP_007609580.1 | holo-ACP synthase | - |
NWE25_RS02460 (NWE25_02460) | 479788..480795 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
NWE25_RS02465 (NWE25_02465) | 480912..482081 | + | 1170 | WP_038457028.1 | alanine racemase | - |
NWE25_RS02470 (NWE25_02470) | 482201..482482 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NWE25_RS02475 (NWE25_02475) | 482488..482838 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NWE25_RS02480 (NWE25_02480) | 482956..483777 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
NWE25_RS02485 (NWE25_02485) | 483782..484147 | + | 366 | WP_007609584.1 | RsbT antagonist protein RsbS | - |
NWE25_RS02490 (NWE25_02490) | 484150..484551 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
NWE25_RS02495 (NWE25_02495) | 484563..485570 | + | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
NWE25_RS02500 (NWE25_02500) | 485634..485963 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
NWE25_RS02505 (NWE25_02505) | 485960..486442 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
NWE25_RS02510 (NWE25_02510) | 486408..487196 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
NWE25_RS02515 (NWE25_02515) | 487196..487798 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T254326 WP_003156187.1 NZ_CP102866:482488-482838 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|