Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 373877..374528 | Replicon | chromosome |
| Accession | NZ_CP102859 | ||
| Organism | Lacticaseibacillus paracasei strain DM001 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | K6S8L5 |
| Locus tag | NJN40_RS01810 | Protein ID | WP_003567661.1 |
| Coordinates | 374145..374528 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | K6RKI5 |
| Locus tag | NJN40_RS01805 | Protein ID | WP_003567665.1 |
| Coordinates | 373877..374125 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NJN40_RS01780 (NJN40_01780) | 368946..370334 | + | 1389 | WP_253613061.1 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
| NJN40_RS01785 (NJN40_01785) | 370365..370508 | + | 144 | WP_003591975.1 | hypothetical protein | - |
| NJN40_RS01790 (NJN40_01790) | 370634..372142 | + | 1509 | WP_003567670.1 | DEAD/DEAH box helicase | - |
| NJN40_RS01795 (NJN40_01795) | 372312..372686 | + | 375 | WP_253613065.1 | holo-ACP synthase | - |
| NJN40_RS01800 (NJN40_01800) | 372673..373809 | + | 1137 | WP_253613067.1 | alanine racemase | - |
| NJN40_RS01805 (NJN40_01805) | 373877..374125 | + | 249 | WP_003567665.1 | antitoxin | Antitoxin |
| NJN40_RS01810 (NJN40_01810) | 374145..374528 | + | 384 | WP_003567661.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NJN40_RS01815 (NJN40_01815) | 374712..375233 | + | 522 | WP_128538209.1 | QueT transporter family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13773.03 Da Isoelectric Point: 10.9764
>T254324 WP_003567661.1 NZ_CP102859:374145-374528 [Lacticaseibacillus paracasei]
MDVSVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSTKMAAVDRALAISVGLVSLPKPKTYNKN
MDVSVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSTKMAAVDRALAISVGLVSLPKPKTYNKN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | K6S8L5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E2BNY2 |