Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 10386..10908 Replicon plasmid p573-5
Accession NZ_CP102858
Organism Escherichia coli strain 573

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag NWH85_RS26095 Protein ID WP_000220560.1
Coordinates 10386..10667 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag NWH85_RS26100 Protein ID WP_000121743.1
Coordinates 10657..10908 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWH85_RS26050 (NWH85_26130) 6230..7396 - 1167 WP_016247741.1 MobP1 family relaxase -
NWH85_RS26055 (NWH85_26135) 7399..7944 - 546 WP_000757693.1 DNA distortion polypeptide 1 -
NWH85_RS26060 (NWH85_26140) 8275..8547 - 273 WP_000160399.1 hypothetical protein -
NWH85_RS26065 (NWH85_26145) 8544..8708 - 165 WP_000003881.1 hypothetical protein -
NWH85_RS26070 (NWH85_26150) 8778..8957 - 180 WP_024135241.1 hypothetical protein -
NWH85_RS26075 (NWH85_26155) 9000..9329 - 330 WP_000866654.1 hypothetical protein -
NWH85_RS26080 (NWH85_26160) 9422..9637 - 216 WP_001180117.1 hypothetical protein -
NWH85_RS26085 (NWH85_26165) 9627..9872 - 246 WP_000356546.1 hypothetical protein -
NWH85_RS26090 (NWH85_26170) 9917..10240 - 324 WP_001181903.1 hypothetical protein -
NWH85_RS26095 (NWH85_26175) 10386..10667 - 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NWH85_RS26100 (NWH85_26180) 10657..10908 - 252 WP_000121743.1 plasmid stabilization protein Antitoxin
NWH85_RS26105 (NWH85_26185) 12143..12982 + 840 WP_001352874.1 replication initiation protein -
NWH85_RS26110 (NWH85_26190) 13003..13845 + 843 WP_258334571.1 replication initiation protein -
NWH85_RS26115 (NWH85_26195) 13849..14292 + 444 WP_001074380.1 hypothetical protein -
NWH85_RS26120 (NWH85_26200) 14432..14788 + 357 WP_001426297.1 DNA distortion polypeptide 3 -
NWH85_RS26125 (NWH85_26205) 14785..15762 - 978 WP_099145427.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..40630 40630


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T254323 WP_000220560.1 NZ_CP102858:c10667-10386 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT254323 WP_000121743.1 NZ_CP102858:c10908-10657 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References