Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 93363..93988 | Replicon | plasmid p573-2 |
Accession | NZ_CP102855 | ||
Organism | Escherichia coli strain 573 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NWH85_RS24570 | Protein ID | WP_000911313.1 |
Coordinates | 93590..93988 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | NWH85_RS24565 | Protein ID | WP_000450520.1 |
Coordinates | 93363..93590 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWH85_RS24565 (93363) | 93363..93590 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NWH85_RS24570 (93590) | 93590..93988 | + | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NWH85_RS24575 (93997) | 93997..96150 | - | 2154 | WP_000009324.1 | type IV conjugative transfer system coupling protein TraD | - |
NWH85_RS24580 (96403) | 96403..97134 | - | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
NWH85_RS24585 (97166) | 97166..97663 | - | 498 | WP_000605857.1 | entry exclusion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / blaCTX-M-14 / fosA3 / aac(3)-IVa / sul2 / floR / blaTEM-1B / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..149702 | 149702 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T254312 WP_000911313.1 NZ_CP102855:93590-93988 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|