Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3480285..3481122 | Replicon | chromosome |
Accession | NZ_CP102853 | ||
Organism | Escherichia coli strain 573 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | NWH85_RS17095 | Protein ID | WP_000227784.1 |
Coordinates | 3480580..3481122 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | NWH85_RS17090 | Protein ID | WP_001297137.1 |
Coordinates | 3480285..3480596 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWH85_RS17065 (3475305) | 3475305..3476252 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
NWH85_RS17070 (3476274) | 3476274..3478265 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
NWH85_RS17075 (3478255) | 3478255..3478869 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
NWH85_RS17080 (3478869) | 3478869..3479198 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
NWH85_RS17085 (3479210) | 3479210..3480100 | + | 891 | WP_000971336.1 | heme o synthase | - |
NWH85_RS17090 (3480285) | 3480285..3480596 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
NWH85_RS17095 (3480580) | 3480580..3481122 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
NWH85_RS17100 (3481178) | 3481178..3482113 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
NWH85_RS17105 (3482521) | 3482521..3483885 | + | 1365 | WP_001000978.1 | MFS transporter | - |
NWH85_RS17110 (3484013) | 3484013..3484504 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
NWH85_RS17115 (3484672) | 3484672..3485583 | + | 912 | WP_000705847.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T254302 WP_000227784.1 NZ_CP102853:3480580-3481122 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|