Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2448228..2448866 | Replicon | chromosome |
Accession | NZ_CP102853 | ||
Organism | Escherichia coli strain 573 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | NWH85_RS11955 | Protein ID | WP_000813794.1 |
Coordinates | 2448690..2448866 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NWH85_RS11950 | Protein ID | WP_001270286.1 |
Coordinates | 2448228..2448644 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWH85_RS11930 (2443380) | 2443380..2444321 | - | 942 | WP_001251319.1 | ABC transporter permease | - |
NWH85_RS11935 (2444322) | 2444322..2445335 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
NWH85_RS11940 (2445353) | 2445353..2446498 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
NWH85_RS11945 (2446743) | 2446743..2448149 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
NWH85_RS11950 (2448228) | 2448228..2448644 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NWH85_RS11955 (2448690) | 2448690..2448866 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NWH85_RS11960 (2449088) | 2449088..2449318 | + | 231 | WP_000494244.1 | YncJ family protein | - |
NWH85_RS11965 (2449410) | 2449410..2451371 | - | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NWH85_RS11970 (2451444) | 2451444..2451980 | - | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
NWH85_RS11975 (2452072) | 2452072..2453247 | + | 1176 | WP_001236319.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2453287..2454552 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T254300 WP_000813794.1 NZ_CP102853:c2448866-2448690 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT254300 WP_001270286.1 NZ_CP102853:c2448644-2448228 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|