Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1333179..1333804 | Replicon | chromosome |
Accession | NZ_CP102853 | ||
Organism | Escherichia coli strain 573 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NWH85_RS06535 | Protein ID | WP_000911330.1 |
Coordinates | 1333406..1333804 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | NWH85_RS06530 | Protein ID | WP_000450524.1 |
Coordinates | 1333179..1333406 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWH85_RS06505 (1328982) | 1328982..1329452 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
NWH85_RS06510 (1329452) | 1329452..1330024 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
NWH85_RS06515 (1330170) | 1330170..1331048 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
NWH85_RS06520 (1331065) | 1331065..1332099 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
NWH85_RS06525 (1332312) | 1332312..1333025 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
NWH85_RS06530 (1333179) | 1333179..1333406 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NWH85_RS06535 (1333406) | 1333406..1333804 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NWH85_RS06540 (1333951) | 1333951..1334814 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
NWH85_RS06545 (1334829) | 1334829..1336844 | + | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
NWH85_RS06550 (1336918) | 1336918..1337616 | + | 699 | WP_000679823.1 | esterase | - |
NWH85_RS06555 (1337726) | 1337726..1337926 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T254293 WP_000911330.1 NZ_CP102853:1333406-1333804 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|