Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 5073830..5074362 | Replicon | chromosome |
Accession | NZ_CP102850 | ||
Organism | Gordonia mangrovi strain HNM0687 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NWF22_RS23005 | Protein ID | WP_160902223.1 |
Coordinates | 5073830..5074162 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NWF22_RS23010 | Protein ID | WP_160902222.1 |
Coordinates | 5074159..5074362 (-) | Length | 68 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWF22_RS22980 (NWF22_22980) | 5069315..5069809 | - | 495 | WP_258321254.1 | hypothetical protein | - |
NWF22_RS22985 (NWF22_22985) | 5070771..5071448 | - | 678 | WP_160902227.1 | hypothetical protein | - |
NWF22_RS22990 (NWF22_22990) | 5071445..5072143 | - | 699 | WP_160902226.1 | hypothetical protein | - |
NWF22_RS22995 (NWF22_22995) | 5072994..5073395 | - | 402 | WP_160902225.1 | type II toxin-antitoxin system VapC family toxin | - |
NWF22_RS23000 (NWF22_23000) | 5073422..5073661 | - | 240 | WP_160902224.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
NWF22_RS23005 (NWF22_23005) | 5073830..5074162 | - | 333 | WP_160902223.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NWF22_RS23010 (NWF22_23010) | 5074159..5074362 | - | 204 | WP_160902222.1 | DUF3018 family protein | Antitoxin |
NWF22_RS23015 (NWF22_23015) | 5074452..5074616 | - | 165 | WP_258321255.1 | antitoxin MazE family protein | - |
NWF22_RS23020 (NWF22_23020) | 5074787..5075173 | - | 387 | WP_160904327.1 | type II toxin-antitoxin system VapC family toxin | - |
NWF22_RS23025 (NWF22_23025) | 5075170..5075298 | - | 129 | WP_258321256.1 | hypothetical protein | - |
NWF22_RS23030 (NWF22_23030) | 5075671..5076057 | - | 387 | WP_160904326.1 | hypothetical protein | - |
NWF22_RS23035 (NWF22_23035) | 5076057..5076698 | - | 642 | WP_160904325.1 | nucleotidyltransferase domain-containing protein | - |
NWF22_RS23040 (NWF22_23040) | 5077946..5078245 | - | 300 | WP_258321257.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
NWF22_RS23045 (NWF22_23045) | 5078247..5078480 | - | 234 | WP_160904323.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 5070218..5078510 | 8292 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12075.02 Da Isoelectric Point: 6.3330
>T254287 WP_160902223.1 NZ_CP102850:c5074162-5073830 [Gordonia mangrovi]
VIRGEIWTVAGGVYASKPRPAVIVQDDLFDSTLSVVVAPMTSQLIEAPLLRIRIPGDRDTISGLDRDSDVMIDKLTAVRR
SNVLTRVGRLTSEQLVEVERSLMAFLGLAR
VIRGEIWTVAGGVYASKPRPAVIVQDDLFDSTLSVVVAPMTSQLIEAPLLRIRIPGDRDTISGLDRDSDVMIDKLTAVRR
SNVLTRVGRLTSEQLVEVERSLMAFLGLAR
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|