Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Fic(toxin) |
Location | 2952627..2953213 | Replicon | chromosome |
Accession | NZ_CP102850 | ||
Organism | Gordonia mangrovi strain HNM0687 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | NWF22_RS13320 | Protein ID | WP_160902132.1 |
Coordinates | 2952627..2953019 (-) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | - |
Locus tag | NWF22_RS13325 | Protein ID | WP_160902221.1 |
Coordinates | 2953016..2953213 (-) | Length | 66 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWF22_RS13305 (NWF22_13305) | 2950200..2951468 | - | 1269 | WP_160902131.1 | DUF222 domain-containing protein | - |
NWF22_RS13310 (NWF22_13310) | 2951851..2952057 | + | 207 | WP_202398480.1 | hypothetical protein | - |
NWF22_RS13315 (NWF22_13315) | 2952118..2952438 | + | 321 | WP_202398481.1 | hypothetical protein | - |
NWF22_RS13320 (NWF22_13320) | 2952627..2953019 | - | 393 | WP_160902132.1 | Fic family protein | Toxin |
NWF22_RS13325 (NWF22_13325) | 2953016..2953213 | - | 198 | WP_160902221.1 | antitoxin Phd | Antitoxin |
NWF22_RS13330 (NWF22_13330) | 2953324..2953446 | - | 123 | WP_258321452.1 | hypothetical protein | - |
NWF22_RS13335 (NWF22_13335) | 2953592..2954068 | - | 477 | Protein_2637 | NAD(P)/FAD-dependent oxidoreductase | - |
NWF22_RS13340 (NWF22_13340) | 2954174..2954536 | - | 363 | WP_160902133.1 | metalloregulator ArsR/SmtB family transcription factor | - |
NWF22_RS13345 (NWF22_13345) | 2954662..2955441 | + | 780 | Protein_2639 | heavy metal translocating P-type ATPase | - |
NWF22_RS13350 (NWF22_13350) | 2955722..2956951 | + | 1230 | WP_258321136.1 | IS110 family transposase | - |
NWF22_RS13355 (NWF22_13355) | 2956976..2958097 | + | 1122 | WP_160904012.1 | cadmium family heavy metal-translocating P-type ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14226.07 Da Isoelectric Point: 4.5728
>T254285 WP_160902132.1 NZ_CP102850:c2953019-2952627 [Gordonia mangrovi]
VIYLDRHDVITAGSVACGEQVHVRDEGLLQAAVARPQVSVFGLDAYPEPWDKAAALLHSLARNHPLVDGNKRTAWASAVV
FLDINDIVPEADLDVDRAEKFVLDVAQGRMDNWPEISITLHDLFVSAKGT
VIYLDRHDVITAGSVACGEQVHVRDEGLLQAAVARPQVSVFGLDAYPEPWDKAAALLHSLARNHPLVDGNKRTAWASAVV
FLDINDIVPEADLDVDRAEKFVLDVAQGRMDNWPEISITLHDLFVSAKGT
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|