Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PHD(antitoxin) |
Location | 1981000..1981652 | Replicon | chromosome |
Accession | NZ_CP102850 | ||
Organism | Gordonia mangrovi strain HNM0687 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NWF22_RS09120 | Protein ID | WP_160904624.1 |
Coordinates | 1981000..1981389 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NWF22_RS09125 | Protein ID | WP_160904623.1 |
Coordinates | 1981386..1981652 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NWF22_RS09095 (NWF22_09095) | 1976336..1977235 | - | 900 | WP_160904629.1 | SMP-30/gluconolactonase/LRE family protein | - |
NWF22_RS09100 (NWF22_09100) | 1977324..1978562 | - | 1239 | WP_160904628.1 | cytochrome P450 | - |
NWF22_RS09105 (NWF22_09105) | 1978818..1979735 | + | 918 | WP_160904627.1 | alpha/beta hydrolase | - |
NWF22_RS09110 (NWF22_09110) | 1979761..1980066 | + | 306 | WP_160904626.1 | EthD family reductase | - |
NWF22_RS09115 (NWF22_09115) | 1980241..1980981 | + | 741 | WP_160904625.1 | FCD domain-containing protein | - |
NWF22_RS09120 (NWF22_09120) | 1981000..1981389 | - | 390 | WP_160904624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NWF22_RS09125 (NWF22_09125) | 1981386..1981652 | - | 267 | WP_160904623.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NWF22_RS09130 (NWF22_09130) | 1981882..1985148 | + | 3267 | WP_160904635.1 | AfsR/SARP family transcriptional regulator | - |
NWF22_RS09135 (NWF22_09135) | 1985141..1985608 | - | 468 | WP_160904622.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13736.68 Da Isoelectric Point: 4.8451
>T254284 WP_160904624.1 NZ_CP102850:c1981389-1981000 [Gordonia mangrovi]
VSLTYVDTSAAMKLIVDEPESEPLLSSLTSAPARRLIASWLLHAELHCAAGRYPDVVSPEALSAVLATIDLIDLTRGDMI
AAGTYAPLRSHDAIHLAVAIRVGADDFLTYDDELAARASRAGLRALSPR
VSLTYVDTSAAMKLIVDEPESEPLLSSLTSAPARRLIASWLLHAELHCAAGRYPDVVSPEALSAVLATIDLIDLTRGDMI
AAGTYAPLRSHDAIHLAVAIRVGADDFLTYDDELAARASRAGLRALSPR
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|