Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 1141263..1141879 Replicon chromosome
Accession NZ_CP102850
Organism Gordonia mangrovi strain HNM0687

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NWF22_RS05245 Protein ID WP_160900315.1
Coordinates 1141263..1141670 (-) Length 136 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag NWF22_RS05250 Protein ID WP_202398153.1
Coordinates 1141667..1141879 (-) Length 71 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NWF22_RS05220 (NWF22_05220) 1136422..1136823 - 402 WP_160900318.1 plasmid pRiA4b ORF-3 family protein -
NWF22_RS05225 (NWF22_05225) 1136774..1138132 - 1359 WP_160900317.1 plasmid pRiA4b ORF-3 family protein -
NWF22_RS05230 (NWF22_05230) 1138736..1139029 + 294 WP_160901357.1 GlsB/YeaQ/YmgE family stress response membrane protein -
NWF22_RS05235 (NWF22_05235) 1139203..1140042 + 840 WP_160900316.1 ABC transporter ATP-binding protein -
NWF22_RS05240 (NWF22_05240) 1140045..1141229 + 1185 WP_233750851.1 ABC transporter permease subunit -
NWF22_RS05245 (NWF22_05245) 1141263..1141670 - 408 WP_160900315.1 PIN domain-containing protein Toxin
NWF22_RS05250 (NWF22_05250) 1141667..1141879 - 213 WP_202398153.1 CopG family transcriptional regulator Antitoxin
NWF22_RS05255 (NWF22_05255) 1142160..1142603 + 444 WP_160901354.1 Hsp20/alpha crystallin family protein -
NWF22_RS05260 (NWF22_05260) 1142755..1143897 + 1143 WP_160900314.1 alpha/beta fold hydrolase -
NWF22_RS05265 (NWF22_05265) 1143923..1144192 - 270 WP_160900313.1 DUF4235 domain-containing protein -
NWF22_RS05270 (NWF22_05270) 1144203..1144436 - 234 WP_160900312.1 DUF3618 domain-containing protein -
NWF22_RS05275 (NWF22_05275) 1144433..1144831 - 399 WP_160900311.1 phage holin family protein -
NWF22_RS05280 (NWF22_05280) 1144853..1145020 - 168 WP_202398151.1 hypothetical protein -
NWF22_RS05285 (NWF22_05285) 1145084..1145722 - 639 WP_160900310.1 Fic family protein -
NWF22_RS05290 (NWF22_05290) 1145729..1145923 - 195 WP_258321418.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1133044..1145911 12867


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-118)

Antitoxin

Ribbon-helix-helix protein, CopG

(4-39)


Sequences

Toxin        


Download         Length: 136 a.a.        Molecular weight: 14343.28 Da        Isoelectric Point: 4.3487

>T254283 WP_160900315.1 NZ_CP102850:c1141670-1141263 [Gordonia mangrovi]
VIVDTSALLAYFDAAEPQHDAVAESIESASEPLVVSPYVVAELDYLVLTRHGSRAERLVLAELASGAWELAAMSRDRLAA
ATAVVEKYADVPIGIADASNIVLADAYQTRTIATLDRRHFGVLRLGDGSAPIIVP

Download         Length: 408 bp

Antitoxin


Download         Length: 71 a.a.        Molecular weight: 7741.76 Da        Isoelectric Point: 4.7863

>AT254283 WP_202398153.1 NZ_CP102850:c1141879-1141667 [Gordonia mangrovi]
MAKTTLYLPDDLKRAIELEARRRAISEAEVVRQALREALSGNTVRPRGALFSGSEPIADRVDELLDGFGE

Download         Length: 213 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References