Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 10732..11312 | Replicon | plasmid pKP4863-2 |
Accession | NZ_CP102843 | ||
Organism | Klebsiella pneumoniae strain KP4863 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A060VNB1 |
Locus tag | NV397_RS26635 | Protein ID | WP_001136729.1 |
Coordinates | 10732..11046 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | NV397_RS26640 | Protein ID | WP_000093040.1 |
Coordinates | 11034..11312 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV397_RS26610 (NV397_26610) | 6678..8639 | + | 1962 | WP_065799589.1 | TraM recognition domain-containing protein | - |
NV397_RS26615 (NV397_26615) | 8639..9370 | + | 732 | WP_032448355.1 | MobC family replication-relaxation protein | - |
NV397_RS26620 (NV397_26620) | 9377..9907 | + | 531 | WP_065521056.1 | hypothetical protein | - |
NV397_RS26625 (NV397_26625) | 9935..10114 | - | 180 | WP_065521055.1 | Rop family plasmid primer RNA-binding protein | - |
NV397_RS26630 (NV397_26630) | 10140..10568 | - | 429 | WP_001140599.1 | hypothetical protein | - |
NV397_RS26635 (NV397_26635) | 10732..11046 | - | 315 | WP_001136729.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NV397_RS26640 (NV397_26640) | 11034..11312 | - | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
NV397_RS26645 (NV397_26645) | 11633..11851 | - | 219 | WP_002193751.1 | TonB family protein | - |
NV397_RS26650 (NV397_26650) | 11848..12219 | - | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
NV397_RS26655 (NV397_26655) | 12493..12738 | - | 246 | WP_004146442.1 | hypothetical protein | - |
NV397_RS26660 (NV397_26660) | 13065..14750 | + | 1686 | WP_032440457.1 | colicin-like bacteriocin tRNase domain-containing protein | - |
NV397_RS26665 (NV397_26665) | 14760..15017 | + | 258 | WP_032440455.1 | colicin E3-like toxin immunity protein | - |
NV397_RS26670 (NV397_26670) | 15102..15251 | + | 150 | WP_219386769.1 | colicin release lysis protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..20110 | 20110 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11847.77 Da Isoelectric Point: 9.8619
>T254279 WP_001136729.1 NZ_CP102843:c11046-10732 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKAGEVIVRAIQQLKTLPDIGRPVPFLPLEYQELVIGFGDSGYVMLYRHDR
EMDRIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKAGEVIVRAIQQLKTLPDIGRPVPFLPLEYQELVIGFGDSGYVMLYRHDR
EMDRIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VNB1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2X1PRM1 |