Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 677..1257 | Replicon | plasmid pKP4863-2 |
Accession | NZ_CP102843 | ||
Organism | Klebsiella pneumoniae strain KP4863 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A060VNB1 |
Locus tag | NV397_RS26570 | Protein ID | WP_001136729.1 |
Coordinates | 677..991 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | NV397_RS26575 | Protein ID | WP_000093040.1 |
Coordinates | 979..1257 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV397_RS26565 (NV397_26565) | 85..513 | - | 429 | WP_001140599.1 | hypothetical protein | - |
NV397_RS26570 (NV397_26570) | 677..991 | - | 315 | WP_001136729.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NV397_RS26575 (NV397_26575) | 979..1257 | - | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
NV397_RS26580 (NV397_26580) | 1578..1796 | - | 219 | WP_002193751.1 | TonB family protein | - |
NV397_RS26585 (NV397_26585) | 1793..2164 | - | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
NV397_RS26590 (NV397_26590) | 2438..2683 | - | 246 | WP_004146442.1 | hypothetical protein | - |
NV397_RS26595 (NV397_26595) | 3010..4695 | + | 1686 | WP_032440457.1 | colicin-like bacteriocin tRNase domain-containing protein | - |
NV397_RS26600 (NV397_26600) | 4705..4962 | + | 258 | WP_032440455.1 | colicin E3-like toxin immunity protein | - |
NV397_RS26605 (NV397_26605) | 5047..5196 | + | 150 | WP_219386769.1 | colicin release lysis protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..20110 | 20110 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11847.77 Da Isoelectric Point: 9.8619
>T254278 WP_001136729.1 NZ_CP102843:c991-677 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKAGEVIVRAIQQLKTLPDIGRPVPFLPLEYQELVIGFGDSGYVMLYRHDR
EMDRIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKAGEVIVRAIQQLKTLPDIGRPVPFLPLEYQELVIGFGDSGYVMLYRHDR
EMDRIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VNB1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2X1PRM1 |