Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 51792..52435 | Replicon | plasmid pKP4863-1 |
| Accession | NZ_CP102842 | ||
| Organism | Klebsiella pneumoniae strain KP4863 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | NV397_RS25805 | Protein ID | WP_094309080.1 |
| Coordinates | 51792..52208 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A6B7Q5S4 |
| Locus tag | NV397_RS25810 | Protein ID | WP_021312476.1 |
| Coordinates | 52205..52435 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV397_RS25765 (NV397_25765) | 47024..47854 | + | 831 | WP_074425395.1 | AraC family transcriptional regulator | - |
| NV397_RS25770 (NV397_25770) | 47985..48110 | - | 126 | Protein_53 | IS481 family transposase | - |
| NV397_RS25775 (NV397_25775) | 48101..48496 | - | 396 | Protein_54 | DNA-binding protein | - |
| NV397_RS25780 (NV397_25780) | 48527..49099 | - | 573 | WP_094309628.1 | hypothetical protein | - |
| NV397_RS25785 (NV397_25785) | 49104..49352 | - | 249 | WP_065801593.1 | hypothetical protein | - |
| NV397_RS25790 (NV397_25790) | 49631..50637 | - | 1007 | Protein_57 | IS110 family transposase | - |
| NV397_RS25795 (NV397_25795) | 51194..51448 | - | 255 | WP_065801592.1 | hypothetical protein | - |
| NV397_RS25800 (NV397_25800) | 51512..51757 | - | 246 | WP_181936996.1 | hypothetical protein | - |
| NV397_RS25805 (NV397_25805) | 51792..52208 | - | 417 | WP_094309080.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NV397_RS25810 (NV397_25810) | 52205..52435 | - | 231 | WP_021312476.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NV397_RS25815 (NV397_25815) | 52807..53319 | - | 513 | WP_065801590.1 | hypothetical protein | - |
| NV397_RS25820 (NV397_25820) | 53624..54964 | + | 1341 | WP_225579868.1 | hypothetical protein | - |
| NV397_RS25825 (NV397_25825) | 55015..55437 | - | 423 | WP_077269076.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul2 / dfrA12 / aadA2 / qacE | cseA / iucA / iucB / iucC / iucD / iutA | 1..186106 | 186106 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14989.47 Da Isoelectric Point: 9.2738
>T254277 WP_094309080.1 NZ_CP102842:c52208-51792 [Klebsiella pneumoniae]
VKKTFMLDTKICSFIMREQPAAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVDATTEIKVALRQAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLVLEDWVN
VKKTFMLDTKICSFIMREQPAAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVDATTEIKVALRQAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLVLEDWVN
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|