Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 35164..35741 | Replicon | plasmid pKP4863-1 |
| Accession | NZ_CP102842 | ||
| Organism | Klebsiella pneumoniae strain KP4863 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A7G3NNX6 |
| Locus tag | NV397_RS25700 | Protein ID | WP_059065587.1 |
| Coordinates | 35409..35741 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A7G3NP82 |
| Locus tag | NV397_RS25695 | Protein ID | WP_032454911.1 |
| Coordinates | 35164..35409 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV397_RS25680 (NV397_25680) | 32198..33418 | - | 1221 | WP_094313437.1 | HlyD family efflux transporter periplasmic adaptor subunit | - |
| NV397_RS25685 (NV397_25685) | 33951..34526 | - | 576 | WP_094313438.1 | hypothetical protein | - |
| NV397_RS25690 (NV397_25690) | 34661..34789 | - | 129 | WP_094308947.1 | IS1 family transposase | - |
| NV397_RS25695 (NV397_25695) | 35164..35409 | + | 246 | WP_032454911.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NV397_RS25700 (NV397_25700) | 35409..35741 | + | 333 | WP_059065587.1 | endoribonuclease MazF | Toxin |
| NV397_RS25705 (NV397_25705) | 35806..35898 | + | 93 | Protein_40 | IS3 family transposase | - |
| NV397_RS25710 (NV397_25710) | 36091..36351 | - | 261 | Protein_41 | hypothetical protein | - |
| NV397_RS25715 (NV397_25715) | 36305..36607 | - | 303 | Protein_42 | antirestriction protein | - |
| NV397_RS25720 (NV397_25720) | 36893..37123 | - | 231 | WP_004118481.1 | hypothetical protein | - |
| NV397_RS25725 (NV397_25725) | 37355..38764 | - | 1410 | Protein_44 | group II intron reverse transcriptase/maturase | - |
| NV397_RS25730 (NV397_25730) | 38807..39994 | - | 1188 | Protein_45 | ISL3 family transposase | - |
| NV397_RS25735 (NV397_25735) | 40112..40561 | - | 450 | WP_105910642.1 | AfaD family invasin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul2 / dfrA12 / aadA2 / qacE | cseA / iucA / iucB / iucC / iucD / iutA | 1..186106 | 186106 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11991.87 Da Isoelectric Point: 7.7494
>T254276 WP_059065587.1 NZ_CP102842:35409-35741 [Klebsiella pneumoniae]
MVSRFVPDAGDLIWINFDPVEGHEQGGHRPAVVLSPFAYNNKTGLLLCVPCTTKVKGYPFEVELPGERDGVALADQITCV
DWRARKVEKKGKVATGELSEIRAKAKALIG
MVSRFVPDAGDLIWINFDPVEGHEQGGHRPAVVLSPFAYNNKTGLLLCVPCTTKVKGYPFEVELPGERDGVALADQITCV
DWRARKVEKKGKVATGELSEIRAKAKALIG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7G3NNX6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7G3NP82 |