Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4605315..4606125 | Replicon | chromosome |
Accession | NZ_CP102841 | ||
Organism | Klebsiella pneumoniae strain KP4863 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | - |
Locus tag | NV397_RS22320 | Protein ID | WP_101968539.1 |
Coordinates | 4605315..4605848 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | NV397_RS22325 | Protein ID | WP_002887278.1 |
Coordinates | 4605859..4606125 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV397_RS22315 (NV397_22315) | 4604146..4605267 | + | 1122 | WP_009309849.1 | cupin domain-containing protein | - |
NV397_RS22320 (NV397_22320) | 4605315..4605848 | - | 534 | WP_101968539.1 | type II toxin-antitoxin system toxin KacT | Toxin |
NV397_RS22325 (NV397_22325) | 4605859..4606125 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
NV397_RS22330 (NV397_22330) | 4606228..4607661 | - | 1434 | WP_065782632.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
NV397_RS22335 (NV397_22335) | 4607651..4608334 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
NV397_RS22340 (NV397_22340) | 4608507..4609892 | + | 1386 | WP_135702016.1 | efflux transporter outer membrane subunit | - |
NV397_RS22345 (NV397_22345) | 4609910..4610254 | + | 345 | WP_032433444.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19826.69 Da Isoelectric Point: 5.2614
>T254272 WP_101968539.1 NZ_CP102841:c4605848-4605315 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLLSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLLSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|