Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3982113..3982732 Replicon chromosome
Accession NZ_CP102841
Organism Klebsiella pneumoniae strain KP4863

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NV397_RS19305 Protein ID WP_002892050.1
Coordinates 3982514..3982732 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NV397_RS19300 Protein ID WP_002892066.1
Coordinates 3982113..3982487 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NV397_RS19290 (NV397_19290) 3977265..3978458 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NV397_RS19295 (NV397_19295) 3978481..3981627 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NV397_RS19300 (NV397_19300) 3982113..3982487 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NV397_RS19305 (NV397_19305) 3982514..3982732 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NV397_RS19310 (NV397_19310) 3982891..3983457 + 567 WP_002892030.1 maltose O-acetyltransferase -
NV397_RS19315 (NV397_19315) 3983429..3983569 - 141 WP_004147370.1 hypothetical protein -
NV397_RS19320 (NV397_19320) 3983590..3984060 + 471 WP_002892026.1 YlaC family protein -
NV397_RS19325 (NV397_19325) 3984035..3985486 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NV397_RS19330 (NV397_19330) 3985587..3986285 + 699 WP_002892021.1 GNAT family protein -
NV397_RS19335 (NV397_19335) 3986282..3986422 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NV397_RS19340 (NV397_19340) 3986422..3986685 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T254271 WP_002892050.1 NZ_CP102841:3982514-3982732 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT254271 WP_002892066.1 NZ_CP102841:3982113-3982487 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References