Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/UPF0150(antitoxin)
Location 3186690..3187321 Replicon chromosome
Accession NZ_CP102841
Organism Klebsiella pneumoniae strain KP4863

Toxin (Protein)


Gene name hicA Uniprot ID A0A1Q8YTV3
Locus tag NV397_RS15570 Protein ID WP_012542177.1
Coordinates 3187145..3187321 (-) Length 59 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A2X1QFN9
Locus tag NV397_RS15565 Protein ID WP_012542176.1
Coordinates 3186690..3187097 (-) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NV397_RS15520 (NV397_15520) 3182668..3183312 - 645 Protein_3048 terminase large subunit -
NV397_RS15525 (NV397_15525) 3183312..3183746 - 435 WP_012542168.1 phage terminase small subunit P27 family -
NV397_RS15530 (NV397_15530) 3183996..3184427 - 432 WP_077255824.1 hypothetical protein -
NV397_RS15535 (NV397_15535) 3184424..3184741 - 318 WP_020803188.1 hypothetical protein -
NV397_RS15540 (NV397_15540) 3184693..3185055 - 363 WP_020803185.1 HNH endonuclease -
NV397_RS15545 (NV397_15545) 3185039..3185245 - 207 WP_032447250.1 hypothetical protein -
NV397_RS15550 (NV397_15550) 3185281..3185757 - 477 WP_050516738.1 DUF2514 domain-containing protein -
NV397_RS15555 (NV397_15555) 3185790..3186320 - 531 WP_023328100.1 lysozyme -
NV397_RS15560 (NV397_15560) 3186298..3186534 - 237 WP_004111739.1 class II holin family protein -
NV397_RS15565 (NV397_15565) 3186690..3187097 - 408 WP_012542176.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NV397_RS15570 (NV397_15570) 3187145..3187321 - 177 WP_012542177.1 type II toxin-antitoxin system HicA family toxin Toxin
NV397_RS15575 (NV397_15575) 3187684..3188841 + 1158 WP_020803203.1 DUF262 domain-containing protein -
NV397_RS15580 (NV397_15580) 3188843..3189532 + 690 WP_012542179.1 MAE_28990/MAE_18760 family HEPN-like nuclease -
NV397_RS15585 (NV397_15585) 3189498..3190541 - 1044 WP_020803204.1 DNA cytosine methyltransferase -
NV397_RS15590 (NV397_15590) 3190631..3190975 - 345 WP_032447265.1 antiterminator Q family protein -
NV397_RS15595 (NV397_15595) 3190988..3192019 - 1032 WP_047670001.1 DUF968 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3137784..3207350 69566


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-57)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-61)


Sequences

Toxin        


Download         Length: 59 a.a.        Molecular weight: 6632.83 Da        Isoelectric Point: 11.0174

>T254270 WP_012542177.1 NZ_CP102841:c3187321-3187145 [Klebsiella pneumoniae]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK

Download         Length: 177 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 14977.99 Da        Isoelectric Point: 4.4277

>AT254270 WP_012542176.1 NZ_CP102841:c3187097-3186690 [Klebsiella pneumoniae]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARMINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q8YTV3

Antitoxin

Source ID Structure
AlphaFold DB A0A2X1QFN9

References