Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 805499..806156 | Replicon | chromosome |
| Accession | NZ_CP102841 | ||
| Organism | Klebsiella pneumoniae strain KP4863 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | NV397_RS03985 | Protein ID | WP_002916310.1 |
| Coordinates | 805746..806156 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | NV397_RS03980 | Protein ID | WP_002916312.1 |
| Coordinates | 805499..805765 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV397_RS03955 (NV397_03955) | 800655..802088 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
| NV397_RS03960 (NV397_03960) | 802207..802935 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| NV397_RS03965 (NV397_03965) | 802985..803296 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| NV397_RS03970 (NV397_03970) | 803460..804119 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
| NV397_RS03975 (NV397_03975) | 804270..805253 | - | 984 | WP_163621823.1 | tRNA-modifying protein YgfZ | - |
| NV397_RS03980 (NV397_03980) | 805499..805765 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| NV397_RS03985 (NV397_03985) | 805746..806156 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
| NV397_RS03990 (NV397_03990) | 806163..806684 | - | 522 | WP_087638529.1 | flavodoxin FldB | - |
| NV397_RS03995 (NV397_03995) | 806785..807681 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| NV397_RS04000 (NV397_04000) | 807704..808417 | + | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NV397_RS04005 (NV397_04005) | 808423..810156 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T254264 WP_002916310.1 NZ_CP102841:805746-806156 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |