Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 10362..10942 | Replicon | plasmid pKP0079-4 |
Accession | NZ_CP102840 | ||
Organism | Klebsiella pneumoniae strain KP0079 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | NV396_RS29055 | Protein ID | WP_071177730.1 |
Coordinates | 10628..10942 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | NV396_RS29050 | Protein ID | WP_000093040.1 |
Coordinates | 10362..10640 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV396_RS29030 (NV396_29030) | 6803..8290 | - | 1488 | WP_004178082.1 | group II intron reverse transcriptase/maturase | - |
NV396_RS29035 (NV396_29035) | 8935..9180 | + | 246 | WP_032440458.1 | hypothetical protein | - |
NV396_RS29040 (NV396_29040) | 9454..9825 | + | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
NV396_RS29045 (NV396_29045) | 9822..10187 | + | 366 | WP_072354022.1 | TonB family protein | - |
NV396_RS29050 (NV396_29050) | 10362..10640 | + | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
NV396_RS29055 (NV396_29055) | 10628..10942 | + | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NV396_RS29060 (NV396_29060) | 11106..11534 | + | 429 | WP_001140599.1 | hypothetical protein | - |
NV396_RS29065 (NV396_29065) | 11560..11739 | + | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
NV396_RS29070 (NV396_29070) | 11766..12296 | - | 531 | WP_071177729.1 | hypothetical protein | - |
NV396_RS29075 (NV396_29075) | 12303..13034 | - | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
NV396_RS29080 (NV396_29080) | 13034..14998 | - | 1965 | WP_071177727.1 | TraM recognition domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..23940 | 23940 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T254261 WP_071177730.1 NZ_CP102840:10628-10942 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|