Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 190326..190969 | Replicon | plasmid pKP0079-1 |
| Accession | NZ_CP102837 | ||
| Organism | Klebsiella pneumoniae strain KP0079 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | NV396_RS27630 | Protein ID | WP_001044770.1 |
| Coordinates | 190553..190969 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | NV396_RS27625 | Protein ID | WP_001261282.1 |
| Coordinates | 190326..190556 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV396_RS27600 (NV396_27600) | 186265..186432 | - | 168 | Protein_203 | IS1 family transposase | - |
| NV396_RS27605 (NV396_27605) | 186737..187666 | + | 930 | WP_004213558.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| NV396_RS27610 (NV396_27610) | 187811..188590 | - | 780 | WP_004213560.1 | site-specific integrase | - |
| NV396_RS27615 (NV396_27615) | 188587..189408 | - | 822 | WP_004213562.1 | hypothetical protein | - |
| NV396_RS27620 (NV396_27620) | 189953..190369 | - | 417 | WP_164481821.1 | hypothetical protein | - |
| NV396_RS27625 (NV396_27625) | 190326..190556 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NV396_RS27630 (NV396_27630) | 190553..190969 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NV396_RS27635 (NV396_27635) | 191043..192605 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
| NV396_RS27640 (NV396_27640) | 192590..193612 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
| NV396_RS27645 (NV396_27645) | 193868..194565 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
| NV396_RS27650 (NV396_27650) | 194594..194866 | + | 273 | Protein_213 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..194877 | 194877 | |
| - | flank | IS/Tn | - | - | 194188..194565 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T254254 WP_001044770.1 NZ_CP102837:190553-190969 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |