Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 190326..190969 Replicon plasmid pKP0079-1
Accession NZ_CP102837
Organism Klebsiella pneumoniae strain KP0079

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NV396_RS27630 Protein ID WP_001044770.1
Coordinates 190553..190969 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NV396_RS27625 Protein ID WP_001261282.1
Coordinates 190326..190556 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NV396_RS27600 (NV396_27600) 186265..186432 - 168 Protein_203 IS1 family transposase -
NV396_RS27605 (NV396_27605) 186737..187666 + 930 WP_004213558.1 Rpn family recombination-promoting nuclease/putative transposase -
NV396_RS27610 (NV396_27610) 187811..188590 - 780 WP_004213560.1 site-specific integrase -
NV396_RS27615 (NV396_27615) 188587..189408 - 822 WP_004213562.1 hypothetical protein -
NV396_RS27620 (NV396_27620) 189953..190369 - 417 WP_164481821.1 hypothetical protein -
NV396_RS27625 (NV396_27625) 190326..190556 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NV396_RS27630 (NV396_27630) 190553..190969 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NV396_RS27635 (NV396_27635) 191043..192605 + 1563 WP_004206609.1 AAA family ATPase -
NV396_RS27640 (NV396_27640) 192590..193612 + 1023 WP_000361404.1 helicase UvrD -
NV396_RS27645 (NV396_27645) 193868..194565 + 698 WP_223174630.1 IS1 family transposase -
NV396_RS27650 (NV396_27650) 194594..194866 + 273 Protein_213 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 1..194877 194877
- flank IS/Tn - - 194188..194565 377


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T254254 WP_001044770.1 NZ_CP102837:190553-190969 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT254254 WP_001261282.1 NZ_CP102837:190326-190556 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References