Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 94420..95090 Replicon plasmid pKP0079-1
Accession NZ_CP102837
Organism Klebsiella pneumoniae strain KP0079

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag NV396_RS27120 Protein ID WP_004213072.1
Coordinates 94420..94863 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag NV396_RS27125 Protein ID WP_004213073.1
Coordinates 94860..95090 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NV396_RS27085 (NV396_27085) 89831..90106 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
NV396_RS27090 (NV396_27090) 90169..90660 + 492 WP_011251327.1 DM13 domain-containing protein -
NV396_RS27095 (NV396_27095) 90709..91629 + 921 WP_004213934.1 DUF1471 domain-containing protein -
NV396_RS27100 (NV396_27100) 91720..92123 + 404 Protein_103 GAF domain-containing protein -
NV396_RS27105 (NV396_27105) 92641..93276 - 636 Protein_104 mucoid phenotype regulator RmpA2 -
NV396_RS27110 (NV396_27110) 93693..93997 + 305 Protein_105 transposase -
NV396_RS27115 (NV396_27115) 94020..94271 - 252 WP_186987481.1 hypothetical protein -
NV396_RS27120 (NV396_27120) 94420..94863 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
NV396_RS27125 (NV396_27125) 94860..95090 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NV396_RS27130 (NV396_27130) 95698..96831 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
NV396_RS27135 (NV396_27135) 96847..97140 + 294 WP_004213076.1 hypothetical protein -
NV396_RS27140 (NV396_27140) 97130..97336 - 207 WP_004213077.1 hypothetical protein -
NV396_RS27145 (NV396_27145) 97688..97978 + 291 WP_004213078.1 hypothetical protein -
NV396_RS27150 (NV396_27150) 97968..98867 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 1..194877 194877


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T254253 WP_004213072.1 NZ_CP102837:c94863-94420 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT254253 WP_004213073.1 NZ_CP102837:c95090-94860 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References