Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 94420..95090 | Replicon | plasmid pKP0079-1 |
| Accession | NZ_CP102837 | ||
| Organism | Klebsiella pneumoniae strain KP0079 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q6U619 |
| Locus tag | NV396_RS27120 | Protein ID | WP_004213072.1 |
| Coordinates | 94420..94863 (-) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | NV396_RS27125 | Protein ID | WP_004213073.1 |
| Coordinates | 94860..95090 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV396_RS27085 (NV396_27085) | 89831..90106 | + | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
| NV396_RS27090 (NV396_27090) | 90169..90660 | + | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| NV396_RS27095 (NV396_27095) | 90709..91629 | + | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| NV396_RS27100 (NV396_27100) | 91720..92123 | + | 404 | Protein_103 | GAF domain-containing protein | - |
| NV396_RS27105 (NV396_27105) | 92641..93276 | - | 636 | Protein_104 | mucoid phenotype regulator RmpA2 | - |
| NV396_RS27110 (NV396_27110) | 93693..93997 | + | 305 | Protein_105 | transposase | - |
| NV396_RS27115 (NV396_27115) | 94020..94271 | - | 252 | WP_186987481.1 | hypothetical protein | - |
| NV396_RS27120 (NV396_27120) | 94420..94863 | - | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NV396_RS27125 (NV396_27125) | 94860..95090 | - | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NV396_RS27130 (NV396_27130) | 95698..96831 | + | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| NV396_RS27135 (NV396_27135) | 96847..97140 | + | 294 | WP_004213076.1 | hypothetical protein | - |
| NV396_RS27140 (NV396_27140) | 97130..97336 | - | 207 | WP_004213077.1 | hypothetical protein | - |
| NV396_RS27145 (NV396_27145) | 97688..97978 | + | 291 | WP_004213078.1 | hypothetical protein | - |
| NV396_RS27150 (NV396_27150) | 97968..98867 | + | 900 | WP_004225022.1 | nucleotide-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..194877 | 194877 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T254253 WP_004213072.1 NZ_CP102837:c94863-94420 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|