Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 60716..61626 Replicon plasmid pKP0079-1
Accession NZ_CP102837
Organism Klebsiella pneumoniae strain KP0079

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag NV396_RS26920 Protein ID WP_004026354.1
Coordinates 60716..61186 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag NV396_RS26925 Protein ID WP_004026357.1
Coordinates 61183..61626 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NV396_RS26880 (NV396_26880) 56032..56346 + 315 WP_011251273.1 hypothetical protein -
NV396_RS26885 (NV396_26885) 56355..56849 + 495 WP_011251274.1 hypothetical protein -
NV396_RS26890 (NV396_26890) 56855..57295 + 441 WP_011251275.1 hypothetical protein -
NV396_RS26895 (NV396_26895) 57720..58676 - 957 WP_011251280.1 DsbA family protein -
NV396_RS26900 (NV396_26900) 58736..59077 - 342 WP_011251281.1 hypothetical protein -
NV396_RS26905 (NV396_26905) 59091..59402 - 312 WP_011251282.1 hypothetical protein -
NV396_RS26910 (NV396_26910) 59419..59868 - 450 WP_011251283.1 thioredoxin fold domain-containing protein -
NV396_RS26920 (NV396_26920) 60716..61186 - 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
NV396_RS26925 (NV396_26925) 61183..61626 - 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
NV396_RS26930 (NV396_26930) 61727..62230 - 504 Protein_69 DUF4113 domain-containing protein -
NV396_RS26935 (NV396_26935) 62436..63416 - 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
NV396_RS26940 (NV396_26940) 63482..64789 + 1308 Protein_71 FepA family TonB-dependent siderophore receptor -
NV396_RS26945 (NV396_26945) 64851..65072 + 222 WP_004213615.1 hypothetical protein -
NV396_RS26950 (NV396_26950) 65416..66378 - 963 WP_004902373.1 DEAD/DEAH box helicase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 1..194877 194877
- inside IScluster/Tn - iroN 54435..68027 13592


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T254252 WP_004026354.1 NZ_CP102837:c61186-60716 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT254252 WP_004026357.1 NZ_CP102837:c61626-61183 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References