Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5324304..5324929 | Replicon | chromosome |
Accession | NZ_CP102836 | ||
Organism | Klebsiella pneumoniae strain KP0079 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | NV396_RS26210 | Protein ID | WP_002882817.1 |
Coordinates | 5324304..5324687 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | NV396_RS26215 | Protein ID | WP_004150355.1 |
Coordinates | 5324687..5324929 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV396_RS26195 (NV396_26195) | 5321670..5322572 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
NV396_RS26200 (NV396_26200) | 5322569..5323204 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
NV396_RS26205 (NV396_26205) | 5323201..5324130 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
NV396_RS26210 (NV396_26210) | 5324304..5324687 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NV396_RS26215 (NV396_26215) | 5324687..5324929 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
NV396_RS26220 (NV396_26220) | 5325134..5326051 | + | 918 | WP_002882812.1 | alpha/beta hydrolase | - |
NV396_RS26225 (NV396_26225) | 5326065..5327006 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
NV396_RS26230 (NV396_26230) | 5327051..5327488 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
NV396_RS26235 (NV396_26235) | 5327485..5328345 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
NV396_RS26240 (NV396_26240) | 5328339..5328938 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T254250 WP_002882817.1 NZ_CP102836:c5324687-5324304 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |