Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4123145..4123764 | Replicon | chromosome |
Accession | NZ_CP102836 | ||
Organism | Klebsiella pneumoniae strain KP0079 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NV396_RS20430 | Protein ID | WP_002892050.1 |
Coordinates | 4123546..4123764 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | NV396_RS20425 | Protein ID | WP_002892066.1 |
Coordinates | 4123145..4123519 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV396_RS20415 (NV396_20415) | 4118297..4119490 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NV396_RS20420 (NV396_20420) | 4119513..4122659 | + | 3147 | WP_020326861.1 | multidrug efflux RND transporter permease subunit AcrB | - |
NV396_RS20425 (NV396_20425) | 4123145..4123519 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
NV396_RS20430 (NV396_20430) | 4123546..4123764 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NV396_RS20435 (NV396_20435) | 4123923..4124489 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
NV396_RS20440 (NV396_20440) | 4124461..4124601 | - | 141 | WP_004147370.1 | hypothetical protein | - |
NV396_RS20445 (NV396_20445) | 4124622..4125092 | + | 471 | WP_002892026.1 | YlaC family protein | - |
NV396_RS20450 (NV396_20450) | 4125067..4126518 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
NV396_RS20455 (NV396_20455) | 4126619..4127317 | + | 699 | WP_002892021.1 | GNAT family protein | - |
NV396_RS20460 (NV396_20460) | 4127314..4127454 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
NV396_RS20465 (NV396_20465) | 4127454..4127717 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T254246 WP_002892050.1 NZ_CP102836:4123546-4123764 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT254246 WP_002892066.1 NZ_CP102836:4123145-4123519 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |