Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4123145..4123764 Replicon chromosome
Accession NZ_CP102836
Organism Klebsiella pneumoniae strain KP0079

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NV396_RS20430 Protein ID WP_002892050.1
Coordinates 4123546..4123764 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NV396_RS20425 Protein ID WP_002892066.1
Coordinates 4123145..4123519 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NV396_RS20415 (NV396_20415) 4118297..4119490 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NV396_RS20420 (NV396_20420) 4119513..4122659 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
NV396_RS20425 (NV396_20425) 4123145..4123519 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NV396_RS20430 (NV396_20430) 4123546..4123764 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NV396_RS20435 (NV396_20435) 4123923..4124489 + 567 WP_002892030.1 maltose O-acetyltransferase -
NV396_RS20440 (NV396_20440) 4124461..4124601 - 141 WP_004147370.1 hypothetical protein -
NV396_RS20445 (NV396_20445) 4124622..4125092 + 471 WP_002892026.1 YlaC family protein -
NV396_RS20450 (NV396_20450) 4125067..4126518 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NV396_RS20455 (NV396_20455) 4126619..4127317 + 699 WP_002892021.1 GNAT family protein -
NV396_RS20460 (NV396_20460) 4127314..4127454 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NV396_RS20465 (NV396_20465) 4127454..4127717 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T254246 WP_002892050.1 NZ_CP102836:4123546-4123764 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT254246 WP_002892066.1 NZ_CP102836:4123145-4123519 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References