Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 3303607..3304238 | Replicon | chromosome |
Accession | NZ_CP102836 | ||
Organism | Klebsiella pneumoniae strain KP0079 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A1Q8YTV3 |
Locus tag | NV396_RS16495 | Protein ID | WP_012542177.1 |
Coordinates | 3304062..3304238 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A3Q9U6R4 |
Locus tag | NV396_RS16490 | Protein ID | WP_017898984.1 |
Coordinates | 3303607..3304014 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV396_RS16455 (NV396_16455) | 3298971..3299405 | - | 435 | WP_012542168.1 | phage terminase small subunit P27 family | - |
NV396_RS16460 (NV396_16460) | 3299653..3300084 | - | 432 | WP_023279521.1 | hypothetical protein | - |
NV396_RS16465 (NV396_16465) | 3300081..3300398 | - | 318 | WP_023279522.1 | hypothetical protein | - |
NV396_RS16470 (NV396_16470) | 3300350..3300712 | - | 363 | WP_014228901.1 | HNH endonuclease | - |
NV396_RS16475 (NV396_16475) | 3301837..3302187 | - | 351 | WP_017898986.1 | hypothetical protein | - |
NV396_RS16480 (NV396_16480) | 3302184..3302681 | - | 498 | WP_023279523.1 | lysozyme | - |
NV396_RS16485 (NV396_16485) | 3302681..3302896 | - | 216 | WP_017880269.1 | class II holin family protein | - |
NV396_RS16490 (NV396_16490) | 3303607..3304014 | - | 408 | WP_017898984.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NV396_RS16495 (NV396_16495) | 3304062..3304238 | - | 177 | WP_012542177.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NV396_RS16500 (NV396_16500) | 3304602..3306386 | + | 1785 | WP_032415155.1 | ATP-binding protein | - |
NV396_RS16505 (NV396_16505) | 3306406..3307440 | + | 1035 | WP_219071718.1 | DNA cytosine methyltransferase | - |
NV396_RS16510 (NV396_16510) | 3307465..3307806 | - | 342 | WP_017898982.1 | antiterminator Q family protein | - |
NV396_RS16515 (NV396_16515) | 3307819..3308850 | - | 1032 | WP_071058942.1 | DUF968 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3270138..3325255 | 55117 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6632.83 Da Isoelectric Point: 11.0174
>T254245 WP_012542177.1 NZ_CP102836:c3304238-3304062 [Klebsiella pneumoniae]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
Download Length: 177 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14959.96 Da Isoelectric Point: 4.4277
>AT254245 WP_017898984.1 NZ_CP102836:c3304014-3303607 [Klebsiella pneumoniae]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YTV3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Q9U6R4 |