Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 80463..80988 Replicon plasmid pKP4962-1
Accession NZ_CP102834
Organism Klebsiella pneumoniae strain KP4962

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag NV394_RS27030 Protein ID WP_013023785.1
Coordinates 80463..80768 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag NV394_RS27035 Protein ID WP_001568025.1
Coordinates 80770..80988 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NV394_RS27000 (NV394_27000) 76174..76800 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
NV394_RS27005 (NV394_27005) 76797..77099 + 303 WP_004197636.1 hypothetical protein -
NV394_RS27010 (NV394_27010) 77539..78333 - 795 WP_004197635.1 site-specific integrase -
NV394_RS27015 (NV394_27015) 78531..79547 - 1017 WP_017899884.1 hypothetical protein -
NV394_RS27020 (NV394_27020) 79558..79872 - 315 WP_053389906.1 hypothetical protein -
NV394_RS27025 (NV394_27025) 79899..80294 - 396 WP_017899885.1 hypothetical protein -
NV394_RS27030 (NV394_27030) 80463..80768 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
NV394_RS27035 (NV394_27035) 80770..80988 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NV394_RS27040 (NV394_27040) 81806..82096 - 291 WP_013023783.1 hypothetical protein -
NV394_RS27045 (NV394_27045) 82093..83220 - 1128 WP_013023782.1 DUF4238 domain-containing protein -
NV394_RS27050 (NV394_27050) 83254..84846 - 1593 WP_015344964.1 hypothetical protein -
NV394_RS27055 (NV394_27055) 85053..85832 - 780 WP_013023780.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul1 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr / tet(A) / floR / blaTEM-1B / blaCTX-M-3 / qnrS1 - 1..130974 130974


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T254235 WP_013023785.1 NZ_CP102834:c80768-80463 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT254235 WP_001568025.1 NZ_CP102834:c80988-80770 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References