Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4871211..4871727 | Replicon | chromosome |
Accession | NZ_CP102833 | ||
Organism | Klebsiella pneumoniae strain KP4962 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NV394_RS23860 | Protein ID | WP_023317444.1 |
Coordinates | 4871211..4871495 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | NV394_RS23865 | Protein ID | WP_002886901.1 |
Coordinates | 4871485..4871727 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV394_RS23835 (4866606) | 4866606..4866869 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
NV394_RS23840 (4866999) | 4866999..4867172 | + | 174 | WP_032408826.1 | hypothetical protein | - |
NV394_RS23845 (4867175) | 4867175..4867918 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
NV394_RS23850 (4868275) | 4868275..4870413 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NV394_RS23855 (4870743) | 4870743..4871207 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NV394_RS23860 (4871211) | 4871211..4871495 | - | 285 | WP_023317444.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NV394_RS23865 (4871485) | 4871485..4871727 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NV394_RS23870 (4871805) | 4871805..4873715 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
NV394_RS23875 (4873738) | 4873738..4874892 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
NV394_RS23880 (4874959) | 4874959..4875699 | - | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11151.99 Da Isoelectric Point: 10.3787
>T254232 WP_023317444.1 NZ_CP102833:c4871495-4871211 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESPRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESPRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|