Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4143179..4143798 | Replicon | chromosome |
| Accession | NZ_CP102833 | ||
| Organism | Klebsiella pneumoniae strain KP4962 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NV394_RS20435 | Protein ID | WP_002892050.1 |
| Coordinates | 4143580..4143798 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | NV394_RS20430 | Protein ID | WP_002892066.1 |
| Coordinates | 4143179..4143553 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV394_RS20420 (4138331) | 4138331..4139524 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NV394_RS20425 (4139547) | 4139547..4142693 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NV394_RS20430 (4143179) | 4143179..4143553 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| NV394_RS20435 (4143580) | 4143580..4143798 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NV394_RS20440 (4143957) | 4143957..4144523 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| NV394_RS20445 (4144495) | 4144495..4144635 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| NV394_RS20450 (4144656) | 4144656..4145126 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| NV394_RS20455 (4145101) | 4145101..4146552 | - | 1452 | WP_032436946.1 | PLP-dependent aminotransferase family protein | - |
| NV394_RS20460 (4146653) | 4146653..4147351 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| NV394_RS20465 (4147348) | 4147348..4147488 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| NV394_RS20470 (4147488) | 4147488..4147751 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T254230 WP_002892050.1 NZ_CP102833:4143580-4143798 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT254230 WP_002892066.1 NZ_CP102833:4143179-4143553 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |