Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4143179..4143798 Replicon chromosome
Accession NZ_CP102833
Organism Klebsiella pneumoniae strain KP4962

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NV394_RS20435 Protein ID WP_002892050.1
Coordinates 4143580..4143798 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NV394_RS20430 Protein ID WP_002892066.1
Coordinates 4143179..4143553 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NV394_RS20420 (4138331) 4138331..4139524 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NV394_RS20425 (4139547) 4139547..4142693 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NV394_RS20430 (4143179) 4143179..4143553 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NV394_RS20435 (4143580) 4143580..4143798 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NV394_RS20440 (4143957) 4143957..4144523 + 567 WP_002892030.1 maltose O-acetyltransferase -
NV394_RS20445 (4144495) 4144495..4144635 - 141 WP_004147370.1 hypothetical protein -
NV394_RS20450 (4144656) 4144656..4145126 + 471 WP_002892026.1 YlaC family protein -
NV394_RS20455 (4145101) 4145101..4146552 - 1452 WP_032436946.1 PLP-dependent aminotransferase family protein -
NV394_RS20460 (4146653) 4146653..4147351 + 699 WP_002892021.1 GNAT family protein -
NV394_RS20465 (4147348) 4147348..4147488 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NV394_RS20470 (4147488) 4147488..4147751 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T254230 WP_002892050.1 NZ_CP102833:4143580-4143798 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT254230 WP_002892066.1 NZ_CP102833:4143179-4143553 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References