Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 1808045..1808688 Replicon chromosome
Accession NZ_CP102833
Organism Klebsiella pneumoniae strain KP4962

Toxin (Protein)


Gene name vagD Uniprot ID A4GZE5
Locus tag NV394_RS08685 Protein ID WP_015874977.1
Coordinates 1808045..1808461 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A4GZE4
Locus tag NV394_RS08690 Protein ID WP_015874976.1
Coordinates 1808458..1808688 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NV394_RS08665 (1803448) 1803448..1804563 - 1116 WP_032447702.1 salmochelin biosynthesis C-glycosyltransferase IroB -
NV394_RS08670 (1804736) 1804736..1805014 - 279 Protein_1697 ISNCY family transposase -
NV394_RS08675 (1805435) 1805435..1807609 + 2175 WP_015874979.1 siderophore salmochelin receptor IroN -
NV394_RS08680 (1807764) 1807764..1808009 - 246 WP_032447699.1 hypothetical protein -
NV394_RS08685 (1808045) 1808045..1808461 - 417 WP_015874977.1 type II toxin-antitoxin system VapC family toxin Toxin
NV394_RS08690 (1808458) 1808458..1808688 - 231 WP_015874976.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NV394_RS08695 (1809131) 1809131..1809511 + 381 WP_015874975.1 YrzE family protein -
NV394_RS08700 (1809699) 1809699..1810669 + 971 Protein_1703 IS21 family transposase -
NV394_RS08705 (1810696) 1810696..1811422 + 727 Protein_1704 IS21-like element helper ATPase IstB -
NV394_RS08710 (1811466) 1811466..1811579 - 114 WP_015874970.1 Hha/YmoA family nucleoid-associated regulatory protein -
NV394_RS08715 (1811822) 1811822..1812031 - 210 WP_032447696.1 TraR/DksA family transcriptional regulator -
NV394_RS08720 (1812021) 1812021..1812602 - 582 WP_000937857.1 DUF2857 domain-containing protein -
NV394_RS08725 (1812587) 1812587..1812769 - 183 WP_072001695.1 hypothetical protein -
NV394_RS08730 (1812791) 1812791..1812976 - 186 WP_000205185.1 AlpA family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - rmpA / iroD / iroC / iroB / iroN / fyuA / ybtE / ybtT / ybtU 1764908..1828364 63456


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14945.39 Da        Isoelectric Point: 8.5464

>T254224 WP_015874977.1 NZ_CP102833:c1808461-1808045 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAGLRGDRIVVSAVTYAEMRFGATGPKASPHHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8749.80 Da        Isoelectric Point: 4.3533

>AT254224 WP_015874976.1 NZ_CP102833:c1808688-1808458 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMVEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A4GZE5

Antitoxin

Source ID Structure
AlphaFold DB A4GZE4

References