Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
Location | 16390..16978 | Replicon | plasmid pAB3927 |
Accession | NZ_CP102832 | ||
Organism | Acinetobacter baumannii strain AB3927 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | A0A0J8TIH5 |
Locus tag | NV385_RS19405 | Protein ID | WP_000438827.1 |
Coordinates | 16390..16677 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | N9M5I3 |
Locus tag | NV385_RS19410 | Protein ID | WP_001983304.1 |
Coordinates | 16664..16978 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV385_RS19385 (NV385_19385) | 12316..13485 | + | 1170 | WP_002134206.1 | MobA/MobL family protein | - |
NV385_RS19390 (NV385_19390) | 14082..15017 | + | 936 | WP_001292329.1 | replication initiation protein RepM | - |
NV385_RS19395 (NV385_19395) | 15095..15613 | + | 519 | WP_000839337.1 | plasmid replication DNA-binding protein | - |
NV385_RS19400 (NV385_19400) | 15823..16122 | + | 300 | WP_000358348.1 | hypothetical protein | - |
NV385_RS19405 (NV385_19405) | 16390..16677 | + | 288 | WP_000438827.1 | BrnT family toxin | Toxin |
NV385_RS19410 (NV385_19410) | 16664..16978 | + | 315 | WP_001983304.1 | BrnA antitoxin family protein | Antitoxin |
NV385_RS19415 (NV385_19415) | 17106..19517 | + | 2412 | WP_000932953.1 | TonB-dependent receptor ZnuD2 | - |
NV385_RS19420 (NV385_19420) | 19822..20283 | + | 462 | WP_000761346.1 | DIP1984 family protein | - |
NV385_RS19425 (NV385_19425) | 20609..20818 | - | 210 | WP_000069474.1 | hypothetical protein | - |
NV385_RS19430 (NV385_19430) | 20811..21113 | - | 303 | WP_001129974.1 | XRE family transcriptional regulator | - |
NV385_RS19435 (NV385_19435) | 21106..21462 | - | 357 | WP_000269904.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..22388 | 22388 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11329.75 Da Isoelectric Point: 5.6762
>T254220 WP_000438827.1 NZ_CP102832:16390-16677 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRYTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRYTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J8TIH5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | N9M5I3 |