Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 450569..451222 | Replicon | chromosome |
Accession | NZ_CP102831 | ||
Organism | Acinetobacter baumannii strain AB3927 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | NV385_RS02195 | Protein ID | WP_000607077.1 |
Coordinates | 450833..451222 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | NV385_RS02190 | Protein ID | WP_001288210.1 |
Coordinates | 450569..450826 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NV385_RS02170 (NV385_02170) | 446085..447092 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
NV385_RS02175 (NV385_02175) | 447111..447488 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
NV385_RS02180 (NV385_02180) | 447670..449160 | + | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
NV385_RS02185 (NV385_02185) | 449209..450381 | - | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
NV385_RS02190 (NV385_02190) | 450569..450826 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
NV385_RS02195 (NV385_02195) | 450833..451222 | + | 390 | WP_000607077.1 | membrane protein | Toxin |
NV385_RS02200 (NV385_02200) | 451992..453077 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
NV385_RS02205 (NV385_02205) | 453155..453721 | + | 567 | WP_000651538.1 | rhombosortase | - |
NV385_RS02210 (NV385_02210) | 453909..456104 | + | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T254217 WP_000607077.1 NZ_CP102831:450833-451222 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|