Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 41703..42346 | Replicon | plasmid pYUHAP5-1 |
| Accession | NZ_CP102828 | ||
| Organism | Salmonella enterica subsp. enterica serovar Indiana strain XZ14C1328 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | NV345_RS23615 | Protein ID | WP_001044768.1 |
| Coordinates | 41703..42119 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | NV345_RS23620 | Protein ID | WP_001261287.1 |
| Coordinates | 42116..42346 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV345_RS23600 | 38202..38792 | - | 591 | WP_000194575.1 | hypothetical protein | - |
| NV345_RS23605 | 38792..39049 | - | 258 | WP_000343085.1 | hypothetical protein | - |
| NV345_RS23610 | 39403..41541 | + | 2139 | WP_000350638.1 | AAA family ATPase | - |
| NV345_RS23615 | 41703..42119 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NV345_RS23620 | 42116..42346 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NV345_RS23625 | 42642..42932 | + | 291 | WP_000111771.1 | hypothetical protein | - |
| NV345_RS23630 | 42922..43821 | + | 900 | WP_000963206.1 | nucleotide-binding protein | - |
| NV345_RS23635 | 43871..46096 | - | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
| NV345_RS23640 | 46098..47186 | - | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | mph(A) / aph(3')-IIa / armA / dfrA17 / aadA5 / oqxB / oqxA / blaCTX-M-65 / floR / sul2 / aph(4)-Ia / aac(3)-IVa / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / tet(A) | - | 1..237848 | 237848 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T254215 WP_001044768.1 NZ_CP102828:c42119-41703 [Salmonella enterica subsp. enterica serovar Indiana]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |