Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 41703..42346 Replicon plasmid pYUHAP5-1
Accession NZ_CP102828
Organism Salmonella enterica subsp. enterica serovar Indiana strain XZ14C1328

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag NV345_RS23615 Protein ID WP_001044768.1
Coordinates 41703..42119 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag NV345_RS23620 Protein ID WP_001261287.1
Coordinates 42116..42346 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NV345_RS23600 38202..38792 - 591 WP_000194575.1 hypothetical protein -
NV345_RS23605 38792..39049 - 258 WP_000343085.1 hypothetical protein -
NV345_RS23610 39403..41541 + 2139 WP_000350638.1 AAA family ATPase -
NV345_RS23615 41703..42119 - 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
NV345_RS23620 42116..42346 - 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NV345_RS23625 42642..42932 + 291 WP_000111771.1 hypothetical protein -
NV345_RS23630 42922..43821 + 900 WP_000963206.1 nucleotide-binding protein -
NV345_RS23635 43871..46096 - 2226 WP_000698737.1 P-loop NTPase fold protein -
NV345_RS23640 46098..47186 - 1089 WP_000952217.1 transcriptional repressor PifC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mph(A) / aph(3')-IIa / armA / dfrA17 / aadA5 / oqxB / oqxA / blaCTX-M-65 / floR / sul2 / aph(4)-Ia / aac(3)-IVa / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / tet(A) - 1..237848 237848


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T254215 WP_001044768.1 NZ_CP102828:c42119-41703 [Salmonella enterica subsp. enterica serovar Indiana]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT254215 WP_001261287.1 NZ_CP102828:c42346-42116 [Salmonella enterica subsp. enterica serovar Indiana]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References