Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3935619..3936244 | Replicon | chromosome |
| Accession | NZ_CP102827 | ||
| Organism | Salmonella enterica subsp. enterica serovar Indiana strain XZ14C1328 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NV345_RS19085 | Protein ID | WP_000911337.1 |
| Coordinates | 3935619..3936017 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | C0PXM4 |
| Locus tag | NV345_RS19090 | Protein ID | WP_000557545.1 |
| Coordinates | 3936017..3936244 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV345_RS19070 (3932294) | 3932294..3932881 | - | 588 | WP_023227728.1 | fimbrial protein | - |
| NV345_RS19075 (3933600) | 3933600..3934232 | - | 633 | WP_023227727.1 | YfdX family protein | - |
| NV345_RS19080 (3934279) | 3934279..3934815 | - | 537 | WP_023227726.1 | STM3031 family outer membrane protein | - |
| NV345_RS19085 (3935619) | 3935619..3936017 | - | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| NV345_RS19090 (3936017) | 3936017..3936244 | - | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NV345_RS19095 (3936412) | 3936412..3936672 | + | 261 | WP_023227725.1 | hypothetical protein | - |
| NV345_RS19100 (3936947) | 3936947..3937753 | + | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
| NV345_RS19110 (3938038) | 3938038..3938796 | - | 759 | WP_000244318.1 | amidase activator ActS | - |
| NV345_RS19115 (3939061) | 3939061..3939606 | + | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
| NV345_RS19120 (3939682) | 3939682..3941199 | - | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3927171..3937753 | 10582 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T254213 WP_000911337.1 NZ_CP102827:c3936017-3935619 [Salmonella enterica subsp. enterica serovar Indiana]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|