Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 2331807..2332329 | Replicon | chromosome |
| Accession | NZ_CP102827 | ||
| Organism | Salmonella enterica subsp. enterica serovar Indiana strain XZ14C1328 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | B5F5Y5 |
| Locus tag | NV345_RS11285 | Protein ID | WP_000221343.1 |
| Coordinates | 2331807..2332091 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | V1H457 |
| Locus tag | NV345_RS11290 | Protein ID | WP_000885424.1 |
| Coordinates | 2332081..2332329 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV345_RS11260 (2326963) | 2326963..2328204 | - | 1242 | WP_023227499.1 | MFS transporter | - |
| NV345_RS11265 (2328194) | 2328194..2329702 | - | 1509 | WP_023227500.1 | FAD-dependent oxidoreductase | - |
| NV345_RS11270 (2329747) | 2329747..2330235 | + | 489 | WP_023227501.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| NV345_RS11275 (2330428) | 2330428..2331507 | + | 1080 | WP_023227502.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| NV345_RS11280 (2331559) | 2331559..2331759 | - | 201 | Protein_2185 | Rid family hydrolase | - |
| NV345_RS11285 (2331807) | 2331807..2332091 | - | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NV345_RS11290 (2332081) | 2332081..2332329 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NV345_RS11295 (2332854) | 2332854..2333186 | + | 333 | WP_023227504.1 | DUF1493 family protein | - |
| NV345_RS11300 (2333337) | 2333337..2334245 | + | 909 | WP_077910000.1 | hypothetical protein | - |
| NV345_RS11305 (2334317) | 2334317..2334604 | - | 288 | WP_071787797.1 | helix-turn-helix domain-containing protein | - |
| NV345_RS11310 (2335068) | 2335068..2335190 | + | 123 | WP_254891910.1 | hypothetical protein | - |
| NV345_RS11315 (2335221) | 2335221..2336687 | - | 1467 | WP_023893409.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T254207 WP_000221343.1 NZ_CP102827:c2332091-2331807 [Salmonella enterica subsp. enterica serovar Indiana]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JSW4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0WPN5 |