Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1351724..1352344 | Replicon | chromosome |
| Accession | NZ_CP102827 | ||
| Organism | Salmonella enterica subsp. enterica serovar Indiana strain XZ14C1328 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NV345_RS06390 | Protein ID | WP_001280991.1 |
| Coordinates | 1351724..1351942 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | NV345_RS06395 | Protein ID | WP_000344807.1 |
| Coordinates | 1351970..1352344 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV345_RS06350 (1346947) | 1346947..1347516 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
| NV345_RS06355 (1347549) | 1347549..1347938 | - | 390 | WP_000961285.1 | MGMT family protein | - |
| NV345_RS06365 (1348169) | 1348169..1349719 | - | 1551 | WP_023210786.1 | EAL domain-containing protein | - |
| NV345_RS06370 (1349944) | 1349944..1350204 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| NV345_RS06375 (1350210) | 1350210..1350350 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| NV345_RS06380 (1350406) | 1350406..1350876 | - | 471 | WP_000136181.1 | YlaC family protein | - |
| NV345_RS06385 (1350994) | 1350994..1351545 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| NV345_RS06390 (1351724) | 1351724..1351942 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NV345_RS06395 (1351970) | 1351970..1352344 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| NV345_RS06400 (1352840) | 1352840..1355989 | - | 3150 | WP_051129102.1 | efflux RND transporter permease AcrB | - |
| NV345_RS06405 (1356012) | 1356012..1357205 | - | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T254206 WP_001280991.1 NZ_CP102827:c1351942-1351724 [Salmonella enterica subsp. enterica serovar Indiana]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT254206 WP_000344807.1 NZ_CP102827:c1352344-1351970 [Salmonella enterica subsp. enterica serovar Indiana]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|