Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 616558..617074 | Replicon | chromosome |
| Accession | NZ_CP102827 | ||
| Organism | Salmonella enterica subsp. enterica serovar Indiana strain XZ14C1328 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A3V5VNJ7 |
| Locus tag | NV345_RS02875 | Protein ID | WP_000220577.1 |
| Coordinates | 616790..617074 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | NV345_RS02870 | Protein ID | WP_000212724.1 |
| Coordinates | 616558..616800 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV345_RS02850 (611578) | 611578..612711 | + | 1134 | WP_023226979.1 | amidohydrolase/deacetylase family metallohydrolase | - |
| NV345_RS02855 (612695) | 612695..613813 | + | 1119 | WP_023137277.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| NV345_RS02860 (613810) | 613810..614550 | + | 741 | WP_000779254.1 | KDGP aldolase family protein | - |
| NV345_RS02865 (614567) | 614567..616480 | + | 1914 | WP_023226980.1 | BglG family transcription antiterminator | - |
| NV345_RS02870 (616558) | 616558..616800 | + | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NV345_RS02875 (616790) | 616790..617074 | + | 285 | WP_000220577.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NV345_RS02880 (617078) | 617078..617542 | - | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NV345_RS02885 (617759) | 617759..619897 | - | 2139 | WP_023226981.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NV345_RS02890 (620306) | 620306..621958 | - | 1653 | WP_000155050.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10912.71 Da Isoelectric Point: 9.8739
>T254203 WP_000220577.1 NZ_CP102827:616790-617074 [Salmonella enterica subsp. enterica serovar Indiana]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V5VNJ7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |