Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 194652..195268 Replicon chromosome
Accession NZ_CP102827
Organism Salmonella enterica subsp. enterica serovar Indiana strain XZ14C1328

Toxin (Protein)


Gene name vapC Uniprot ID Q8Z2U3
Locus tag NV345_RS00970 Protein ID WP_000238494.1
Coordinates 194894..195268 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag NV345_RS00965 Protein ID WP_001523745.1
Coordinates 194652..194894 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NV345_RS00930 (189778) 189778..190377 + 600 WP_023227076.1 glucose-1-phosphatase -
NV345_RS00935 (190371) 190371..191243 + 873 WP_000921423.1 virulence factor BrkB family protein -
NV345_RS00940 (191240) 191240..191677 + 438 WP_000560969.1 D-aminoacyl-tRNA deacylase -
NV345_RS00945 (191722) 191722..192663 + 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
NV345_RS00950 (192678) 192678..193124 - 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin -
NV345_RS00955 (193121) 193121..193432 - 312 WP_000558165.1 type II toxin-antitoxin system HigB family toxin -
NV345_RS00960 (193518) 193518..194447 - 930 WP_001162861.1 alpha/beta hydrolase -
NV345_RS00965 (194652) 194652..194894 + 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
NV345_RS00970 (194894) 194894..195268 + 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin Toxin
NV345_RS00975 (195306) 195306..196235 - 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
NV345_RS00980 (196232) 196232..196867 - 636 WP_000829028.1 formate dehydrogenase cytochrome b556 subunit -
NV345_RS00985 (196864) 196864..197766 - 903 WP_051129234.1 formate dehydrogenase subunit beta -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13908.18 Da        Isoelectric Point: 7.3567

>T254202 WP_000238494.1 NZ_CP102827:194894-195268 [Salmonella enterica subsp. enterica serovar Indiana]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT254202 WP_001523745.1 NZ_CP102827:194652-194894 [Salmonella enterica subsp. enterica serovar Indiana]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I6CND8

Antitoxin

Source ID Structure

References