Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1133365..1134038 | Replicon | chromosome |
| Accession | NZ_CP102826 | ||
| Organism | Saccharopolyspora rosea strain A22 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NV263_RS05565 | Protein ID | WP_263251474.1 |
| Coordinates | 1133604..1134038 (+) | Length | 145 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NV263_RS05560 | Protein ID | WP_263251473.1 |
| Coordinates | 1133365..1133607 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NV263_RS05545 | 1128739..1131372 | + | 2634 | WP_263251470.1 | valine--tRNA ligase | - |
| NV263_RS05550 | 1131477..1132844 | + | 1368 | WP_263251471.1 | folylpolyglutamate synthase/dihydrofolate synthase family protein | - |
| NV263_RS05555 | 1132841..1133296 | + | 456 | WP_263251472.1 | DUF4233 domain-containing protein | - |
| NV263_RS05560 | 1133365..1133607 | + | 243 | WP_263251473.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| NV263_RS05565 | 1133604..1134038 | + | 435 | WP_263251474.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NV263_RS05570 | 1134035..1135135 | - | 1101 | WP_263251475.1 | zinc-binding dehydrogenase | - |
| NV263_RS05575 | 1135280..1136823 | + | 1544 | Protein_1082 | alkaline phosphatase D family protein | - |
| NV263_RS05580 | 1136933..1137343 | + | 411 | WP_263251476.1 | nucleoside-diphosphate kinase | - |
| NV263_RS05585 | 1137348..1137893 | + | 546 | WP_263251477.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 16058.43 Da Isoelectric Point: 6.3234
>T254199 WP_263251474.1 NZ_CP102826:1133604-1134038 [Saccharopolyspora rosea]
VIACDVNILLNAQNAALPDHERFATWFEDALNGATPVGIPSMVFSGYLRIVTNHRIWPRPLQPEQALEIIAAIRTAPAFA
PIEPGPRHWEIFAELCRKAQVKANLVPDAYLAAIAIEHGCEWITADRGFARYPGVRWRHPLDDG
VIACDVNILLNAQNAALPDHERFATWFEDALNGATPVGIPSMVFSGYLRIVTNHRIWPRPLQPEQALEIIAAIRTAPAFA
PIEPGPRHWEIFAELCRKAQVKANLVPDAYLAAIAIEHGCEWITADRGFARYPGVRWRHPLDDG
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|